SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces...    27   2.1  
SPBC11C11.01 ||SPBC17D1.08|RNA-binding protein|Schizosaccharomyc...    26   6.5  
SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosacc...    25   8.6  

>SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3131

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 509  DEYILIADRMYVDLIYSEFRAIILPQSAYIIK 604
            DEY+  A+   VD++Y   +  I+  S YI+K
Sbjct: 2909 DEYLYHAEIQNVDILYISTKHFIITGSNYIVK 2940


>SPBC11C11.01 ||SPBC17D1.08|RNA-binding protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 493

 Score = 25.8 bits (54), Expect = 6.5
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = -3

Query: 146 LKGVNFTEAQRSNLIGFLVEHI*NNVVI 63
           ++G+N  +    NL+ F VEH+ N+V I
Sbjct: 248 IQGLNCEKGSIGNLLCFAVEHVNNHVEI 275


>SPBC2F12.05c |||sterol binding ankyrin repeat
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1310

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 6/48 (12%)
 Frame = +3

Query: 258 LHMTVLNSVFLNEHAKLYYRHLLRNDQ------AEARKTILNADDVYE 383
           LH TVL  + L   A+ YY+  L N +      AE  KT++   D  E
Sbjct: 454 LHKTVLEMLDLQRQAEHYYKRKLDNAKAINALWAENLKTVVEEQDQIE 501


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,727,889
Number of Sequences: 5004
Number of extensions: 53262
Number of successful extensions: 141
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 141
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 353266144
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -