SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC19G12.08 |||fatty acid hydroxylase |Schizosaccharomyces pomb...    29   0.46 
SPCC1322.09 |||conserved fungal protein|Schizosaccharomyces pomb...    27   1.9  
SPCC757.13 |||membrane transporter |Schizosaccharomyces pombe|ch...    26   4.3  
SPAC328.05 |||RNA-binding protein involved in export of mRNAs|Sc...    26   5.7  
SPBC106.04 |ada1||adenosine deaminase Ada1 |Schizosaccharomyces ...    25   7.5  
SPBC1711.05 |||nucleocytoplasmic transport chaperone Srp40 |Schi...    25   9.9  
SPCC188.13c |dcr1|SPCC584.10c|dicer|Schizosaccharomyces pombe|ch...    25   9.9  

>SPAC19G12.08 |||fatty acid hydroxylase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 347

 Score = 29.5 bits (63), Expect = 0.46
 Identities = 11/43 (25%), Positives = 27/43 (62%)
 Frame = +3

Query: 186 RAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQQFKQM 314
           R  ++Q + DI+   ++   ++A V + ++ K+PL+N++F  +
Sbjct: 35  RRYHRQEVADILNATSKSKHSEAVVEILKSAKVPLKNKEFSDL 77


>SPCC1322.09 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 455

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 13/134 (9%)
 Frame = +3

Query: 96  ADVNSLVHQYLEKI-----DKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNK-AKAK 257
           A ++ +V++  EK+        L     K+ K +PR  +      +   + +  K AKA 
Sbjct: 229 AHLDRIVYESFEKVMFQVEGGELTVLLDKEAKVRPRTNDVYEDFGLCNGYLEAKKLAKAN 288

Query: 258 V--PVTRAKKMPLRNQQFK-QMGKFQQLRKKLKVQI----LVAPMMSHQNRHLSPTKQLK 416
           +  P+T AKKM   N+Q     G  +   +   V++    LV    + +N+ +S  +QL 
Sbjct: 289 LAEPITEAKKMNKENKQENVGAGDDEDASESPMVRVTHLLLVIQAFTIKNKEVSDDEQLC 348

Query: 417 NLTLHQLRNKNHQM 458
            L +H L + NH +
Sbjct: 349 FL-IH-LNDTNHNL 360


>SPCC757.13 |||membrane transporter |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 522

 Score = 26.2 bits (55), Expect = 4.3
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 1/55 (1%)
 Frame = -3

Query: 331 SCWNFPICLNCWFLRGIFFARVTGTXXXXXXXXXXXAMMSKR-VCWFLARGFALV 170
           +C N P  L   FL GIF A +T                  R +CW+   G A +
Sbjct: 161 ACRNGPSLLGLRFLAGIFEASITPAFINITAMWYRREEQPMRTLCWYAFNGIAQI 215


>SPAC328.05 |||RNA-binding protein involved in export of
           mRNAs|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 25.8 bits (54), Expect = 5.7
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +2

Query: 539 HKKKRNHQMTIVVMMNLRKRFHKNQLLHLPNFQSNKL 649
           +++ R+  + IVVM ++++  H  Q+LH  +F    L
Sbjct: 217 NQEGRSRGIGIVVMSSMKEAMHAIQMLHNTDFMGRTL 253


>SPBC106.04 |ada1||adenosine deaminase Ada1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 846

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +3

Query: 384 NRHLSPTKQLKNLTLHQLRNKNHQMTAT 467
           N+H+ P+K   N  L +L +K   MT T
Sbjct: 763 NKHVQPSKHPSNHDLEELIHKYDAMTGT 790


>SPBC1711.05 |||nucleocytoplasmic transport chaperone Srp40
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 451

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +3

Query: 90  IQADVNSLVHQYLEKIDK-SLAQTFMKKTKAKPRAKN--QQTLLDIIAK 227
           +++ V  L++ +L++      AQTF+K+T  K  AK   ++ LLD++++
Sbjct: 6   MKSKVCPLIYHFLQENGYVKTAQTFLKETGDKDLAKGKVKKNLLDLLSQ 54


>SPCC188.13c |dcr1|SPCC584.10c|dicer|Schizosaccharomyces pombe|chr
            3|||Manual
          Length = 1374

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 6/73 (8%)
 Frame = +3

Query: 243  KAKAKVPVTRAKKMPLR------NQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPT 404
            K K K P    KK+PLR        + K + K QQ+R      + + P+    +RHL  +
Sbjct: 826  KKKDKAPSALCKKLPLRLNYSLWGNRAKSIPKSQQVRSFYINDLYILPV----SRHLKNS 881

Query: 405  KQLKNLTLHQLRN 443
              L    L+ + N
Sbjct: 882  ALLIPSILYHIEN 894


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,152,379
Number of Sequences: 5004
Number of extensions: 35239
Number of successful extensions: 117
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 116
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 307866294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -