SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce...    27   3.9  
SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha...    27   3.9  
SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subun...    26   5.1  
SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|c...    26   6.7  
SPBC582.10c |||ATP-dependent DNA helicase Rhp16b |Schizosaccharo...    26   6.7  
SPBC24C6.06 |gpa1||G-protein alpha subunit |Schizosaccharomyces ...    25   8.9  
SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    25   8.9  

>SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1297

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = -3

Query: 289 FFISN*MPSDRHLN*LSSSSKMGKTIFDILKRLMRWLLQINHP 161
           F+  N +P D+ L   +S  +  K IFD+  +L   +L + HP
Sbjct: 727 FYFDNSLPEDQSLLFPASLKRSAKNIFDLAYQL-NGILPVFHP 768


>SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 4196

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 12/50 (24%), Positives = 23/50 (46%)
 Frame = +3

Query: 555  LRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRF 704
            L FF+  +    RGG+    F  ++  +QN     +A  + + D  +L +
Sbjct: 3826 LNFFETCSDSNERGGLESLFFKTHASNIQNFCTEVLANTHCEEDCLKLLY 3875


>SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subunit
           Rpc2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1165

 Score = 26.2 bits (55), Expect = 5.1
 Identities = 9/38 (23%), Positives = 17/38 (44%)
 Frame = +3

Query: 39  MPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAY 152
           +P+G  P  +R N+C+ +     +     + P  P  Y
Sbjct: 155 VPIGRMPVMLRSNKCVLSGKNEMEMAALNECPLDPGGY 192


>SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 339

 Score = 25.8 bits (54), Expect = 6.7
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%)
 Frame = +1

Query: 202 KCQKWFCPFSTKTTI--NSNDDR*AFSWK 282
           KCQ W C F+   TI  +S DD     WK
Sbjct: 289 KCQVWRCRFNVTGTILSSSGDDGCVRLWK 317


>SPBC582.10c |||ATP-dependent DNA helicase Rhp16b
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 830

 Score = 25.8 bits (54), Expect = 6.7
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -3

Query: 262 DRHLN*LSSSSKMGKTIFDILKRLMRWLLQINHPSS 155
           +R ++   +S K+GK   +IL  L+R     NHP S
Sbjct: 520 ERTMSNFVNSGKLGKNYTNILCLLLRLRQACNHPQS 555


>SPBC24C6.06 |gpa1||G-protein alpha subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 407

 Score = 25.4 bits (53), Expect = 8.9
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +3

Query: 573 TNARTHRG-GVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETGLV 746
           T  RT +  G    L +N+  + Q+ I R   P+Y+  D + L  R   T I +ET L+
Sbjct: 174 TKLRTVQSCGTNLSLLDNFY-YYQDHIDRIFDPQYIPSDQDILHCRIKTTGISEETFLL 231


>SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 601

 Score = 25.4 bits (53), Expect = 8.9
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +1

Query: 436 IYRSFTSGTQRVIHSVYATTRSILAPQTRTRFVR 537
           ++     GT +V ++     +S L PQTR+ F+R
Sbjct: 322 LFERLKVGTNKVKNNSVNIAQSFLEPQTRSTFLR 355


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,180,320
Number of Sequences: 5004
Number of extensions: 63750
Number of successful extensions: 156
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 151
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 156
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 365309308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -