SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce...    29   0.69 
SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|...    27   2.8  
SPAC6F12.16c |mtr4||ATP-dependent RNA helicase, TRAMP complex su...    27   2.8  
SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pom...    26   4.8  
SPAC23H4.03c |erv25||COPII-coated vesicle component Erv25 |Schiz...    26   4.8  

>SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1610

 Score = 29.1 bits (62), Expect = 0.69
 Identities = 31/105 (29%), Positives = 43/105 (40%), Gaps = 4/105 (3%)
 Frame = +1

Query: 400  KRGGGYFSFHC--WFSKITRTCINNFRLRRYNDLSPLQ--LGNVLYEPCTYDMQKLGSFI 567
            K    +F+F    W +KI+ +CI  F  + + D   +   L  V  EP   DM  +G+  
Sbjct: 816  KLPSNFFTFPASFWDAKIS-SCIPFFSNKLFIDQDFILGFLDLVASEPINVDMTDVGTQF 874

Query: 568  LVSLSARDKLICKSYRQNYVNFNGCHKAFSFSLLFVRLRIRFYCQ 702
            +    A        Y   YV   GC     F+L F  L IR Y Q
Sbjct: 875  VHIFHA------SLYTLYYVETTGCDGDALFNLTFAYLLIRIYLQ 913


>SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1372

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = +1

Query: 466  NFRLRRYNDLSPLQLGNVLYEPCTYDMQKLGSF 564
            + RL R+N L+P+++    +  C +D+ +L  F
Sbjct: 950  SIRLHRFNSLTPIEIAKKFFH-CDHDIMELVDF 981


>SPAC6F12.16c |mtr4||ATP-dependent RNA helicase, TRAMP complex
           subunit Mtr4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1117

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -2

Query: 602 QINLSRAERDTKIKLPNFCISYVQG 528
           Q+   R +  T +  PNFC+S++QG
Sbjct: 700 QLERYRTDVRTVVNHPNFCLSFLQG 724


>SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1125

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -2

Query: 197 SNLC*TIFYLNVCYNHFSLNSVNSSTTKRFSN 102
           SN   ++ YLN   NH   NSV S+++ +F+N
Sbjct: 410 SNHTVSLGYLNDRPNHSKKNSVTSTSSSQFNN 441


>SPAC23H4.03c |erv25||COPII-coated vesicle component Erv25
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 216

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = -2

Query: 179 IFYLNVCYNHFSLNSVNSSTTKRFSNCSTKTFVFVKKILLLQLLY 45
           I+YL      F   + N ST +R  N +  TF+ +  +++ Q+LY
Sbjct: 162 IYYLQAREARF--RNTNESTNERVKNFAYLTFISLFVLVIWQILY 204


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,940,597
Number of Sequences: 5004
Number of extensions: 59431
Number of successful extensions: 137
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 137
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 347244562
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -