SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||...    28   1.2  
SPBC713.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    27   2.9  
SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces po...    27   2.9  
SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|...    27   3.8  
SPBC17D11.04c |||histone acetyltransferase complex subunit Nto1 ...    26   5.0  
SPAC17G8.01c |trl1|SPAC6C3.10c|tRNA ligase Trl1 |Schizosaccharom...    26   5.0  
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    26   6.6  
SPBP4H10.05c |spe2||S-adenosylmethionine decarboxylase proenzyme...    26   6.6  
SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ...    25   8.7  

>SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1158

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +3

Query: 78  APTPSRASFDNGYSEFCDKQQPNDYLNYYNNP-TPDGADTVVSDSETAAASNFLASVNSL 254
           +P P  +S D+  S        N++L       T D  D+V+SDS T    +    VNSL
Sbjct: 290 SPPPGLSSMDSNGSSI-----ENNFLYTKRRANTSDSFDSVLSDSSTTPTISSSVQVNSL 344

Query: 255 LMIT 266
             IT
Sbjct: 345 AFIT 348


>SPBC713.09 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 395

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 93  RASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLAS 242
           +A   N  +E    ++ ND  N  N PT +    VV ++E  +ASN +++
Sbjct: 24  QAKSKNSVAEDNVDRESNDGNNQVNEPTGNDNTQVVENTEDISASNVVSA 73


>SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 361

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = -2

Query: 316 NCFSEIISGLEQTFHYIVIISNELTLAKKF 227
           +CF  ++  L+QT+  I II+ E  +AKKF
Sbjct: 79  HCFETLVQHLQQTYPDICIIT-ETDVAKKF 107


>SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 828

 Score = 26.6 bits (56), Expect = 3.8
 Identities = 12/49 (24%), Positives = 22/49 (44%)
 Frame = -3

Query: 261 SSVTN*RLPKSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLN 115
           +S+T     K  ++  S   ++ C +  +WDC     + WA +    LN
Sbjct: 62  TSLTKMLQSKDFRIRWSAIILIHCTISQSWDCLVEHGATWAKLLIALLN 110


>SPBC17D11.04c |||histone acetyltransferase complex subunit Nto1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 767

 Score = 26.2 bits (55), Expect = 5.0
 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%)
 Frame = +3

Query: 96  ASFDNGYSE-FCDKQQPNDYLN 158
           AS+D+   E +CDK  P DYLN
Sbjct: 348 ASYDSVDMETYCDKHTPPDYLN 369


>SPAC17G8.01c |trl1|SPAC6C3.10c|tRNA ligase Trl1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 787

 Score = 26.2 bits (55), Expect = 5.0
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%)
 Frame = -3

Query: 183 HPAWD----CYNNSNSRWAVVYHKTLNSRCRTTLGTAS 82
           H  WD    C+  + +  +V Y KT N +   TLGT+S
Sbjct: 702 HLVWDDRVICFRVTMNENSVWYGKTCNPQLHITLGTSS 739


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 25.8 bits (54), Expect = 6.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +3

Query: 33  QTTMTQINFNASYTSAPTPSRASF 104
           Q +  + +FNA+   APTPS A+F
Sbjct: 869 QPSYEEESFNATVIHAPTPSTATF 892


>SPBP4H10.05c |spe2||S-adenosylmethionine decarboxylase proenzyme
           Spe2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 378

 Score = 25.8 bits (54), Expect = 6.6
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = -3

Query: 222 LLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTAS 82
           L Q++C++L        D Y  S S   V  HK +   C TT   AS
Sbjct: 61  LAQAQCKVLSVVNSEEIDAYLLSESSMFVFAHKIILKTCGTTTLLAS 107


>SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 582

 Score = 25.4 bits (53), Expect = 8.7
 Identities = 10/43 (23%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +3

Query: 519 YKKSTIQSCATLEQTIN-HNTNICTVASTQEITHYFTNDFAPY 644
           Y  +T      +  + N +NT   T  + QEI + +++++ P+
Sbjct: 203 YSTNTAHDATDIPSSFNFYNTQASTAPNPQEINYQWSHEYRPH 245


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,947,932
Number of Sequences: 5004
Number of extensions: 61064
Number of successful extensions: 214
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 214
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 357280532
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -