SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC553.10 |||conserved fungal protein|Schizosaccharomyces pombe...    27   1.5  
SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p...    27   2.0  
SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pomb...    26   3.5  
SPAC22F3.10c |gcs1|apd1|glutamate-cysteine ligase Gcs1 |Schizosa...    25   6.1  
SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    25   8.1  
SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizos...    25   8.1  

>SPCC553.10 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 349

 Score = 27.5 bits (58), Expect = 1.5
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +1

Query: 199 STSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAPTHSAHYQI 327
           S+S+ S++R  S  T   T S  +  + RP VF  T  +HY I
Sbjct: 163 SSSSKSSSRSSSRTTSHRTTSH-KSSSYRPTVFPYTTISHYNI 204


>SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 728

 Score = 27.1 bits (57), Expect = 2.0
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLL 394
           L+ K GV+ L+ K KLP+ +  ++ ++
Sbjct: 542 LLVKDGVVHLVDKVKLPFSVSQKDMII 568


>SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 262

 Score = 26.2 bits (55), Expect = 3.5
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +1

Query: 178 IVNGQYVSTSTASTNRRLSMPTKSSTCS 261
           I  G Y STS +ST+   + P+ SST S
Sbjct: 129 ISGGIYSSTSASSTSSSTATPSSSSTTS 156


>SPAC22F3.10c |gcs1|apd1|glutamate-cysteine ligase Gcs1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 669

 Score = 25.4 bits (53), Expect = 6.1
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +3

Query: 117 GDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHAD 242
           GDE     V+ D  S    V+  +   ++  GKY+ TF H D
Sbjct: 48  GDEIECIVVSMDDKSKKARVSLRQEDILNALGKYEETFRHVD 89


>SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 646

 Score = 25.0 bits (52), Expect = 8.1
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 198 HVLPVHNLHILNCW 157
           HVLP+  L +LNC+
Sbjct: 405 HVLPIRQLFLLNCY 418


>SPCC1322.12c |bub1||serine/threonine protein kinase
           Bub1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1044

 Score = 25.0 bits (52), Expect = 8.1
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -1

Query: 240 RHAQTSICTCRRRGHVLPVHNLHILN 163
           R A T +   R    +LPVH LH+ +
Sbjct: 776 RQAMTRLKGLRETNSILPVHQLHMFH 801


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,503,817
Number of Sequences: 5004
Number of extensions: 53368
Number of successful extensions: 150
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 145
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 150
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 250133048
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -