SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces...    36   0.008
SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce...    31   0.22 
SPAC9.04 |Tf2-1||retrotransposable element|Schizosaccharomyces p...    29   0.88 
SPBC9B6.02c |Tf2-9|SPBC9B6.02|retrotransposable element|Schizosa...    29   0.88 
SPAC13D1.01c |Tf2-7||retrotransposable element|Schizosaccharomyc...    29   0.88 
SPAC27E2.08 |Tf2-6||retrotransposable element|Schizosaccharomyce...    29   0.88 
SPAC19D5.09c |Tf2-8|SPAC13D1.02c|retrotransposable element|Schiz...    29   0.88 
SPAC2E1P3.03c |Tf2-3||retrotransposable element|Schizosaccharomy...    29   0.88 
SPAC26A3.13c |Tf2-4||retrotransposable element|Schizosaccharomyc...    29   0.88 
SPCC1020.14 |Tf2-12||retrotransposable element|Schizosaccharomyc...    29   0.88 
SPBC1289.17 |Tf2-11|SPBC8E4.11c|retrotransposable element|Schizo...    29   0.88 
SPAPB15E9.03c |Tf2-5||retrotransposable element|Schizosaccharomy...    29   0.88 
SPAC167.08 |Tf2-2|SPAC1705.01c|retrotransposable element|Schizos...    29   0.88 
SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosacc...    26   4.7  
SPBC16E9.18 ||SPBC1E8.01|phosphatidylserine decarboxylase|Schizo...    25   8.2  
SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar...    25   8.2  
SPBC19G7.01c |msh2|swi8, mut3, SPBC24C6.12c|MutS protein homolog...    25   8.2  

>SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3131

 Score = 35.5 bits (78), Expect = 0.008
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +3

Query: 402  GKLADDEYILIADRMYVDLIYSEFRAIILPQSAYIIKEITQKAIVKAGKVSTFVMNSNIL 581
            GK A DEY+  A+   VD++Y   +  I+  S YI+K       +   +VS   +NS+ L
Sbjct: 2904 GKYAFDEYLYHAEIQNVDILYISTKHFIITGSNYIVKIAVPVKQISGLRVSEHDLNSSCL 2963


>SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1242

 Score = 30.7 bits (66), Expect = 0.22
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -3

Query: 541  AFTIAFCVISFIMYAL*GKIMALNSE*IKSTYMRSAIKMYSSSASLPM-YLMTVSMMIFK 365
            A+ I F  ISF MYA+   +  L  + ++S   +  +K+   S  + + YL+   + IF 
Sbjct: 1005 AYAIGFYSISFPMYAIHASVKFLKLDYLRSLMNKLNLKIVMRSLVMALKYLLLAFLGIFI 1064

Query: 364  TPML 353
             P+L
Sbjct: 1065 LPLL 1068


>SPAC9.04 |Tf2-1||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPBC9B6.02c |Tf2-9|SPBC9B6.02|retrotransposable
           element|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAC13D1.01c |Tf2-7||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAC27E2.08 |Tf2-6||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAC19D5.09c |Tf2-8|SPAC13D1.02c|retrotransposable
           element|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAC2E1P3.03c |Tf2-3||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAC26A3.13c |Tf2-4||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPCC1020.14 |Tf2-12||retrotransposable element|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPBC1289.17 |Tf2-11|SPBC8E4.11c|retrotransposable
           element|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAPB15E9.03c |Tf2-5||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPAC167.08 |Tf2-2|SPAC1705.01c|retrotransposable
           element|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1333

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +1

Query: 169 HMTVLNSVFLNEHAKLYY--RHLLRNDQAEAEKQFS 270
           H T   S+F NEH K  Y   HL   +Q  AE+ FS
Sbjct: 65  HFTEYPSLFPNEHTKRQYTLNHLEELEQQFAERMFS 100


>SPBC2F12.05c |||sterol binding ankyrin repeat
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1310

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 151 NENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQA 249
           N  + LH TVL  + L   A+ YY+  L N +A
Sbjct: 449 NSFNTLHKTVLEMLDLQRQAEHYYKRKLDNAKA 481


>SPBC16E9.18 ||SPBC1E8.01|phosphatidylserine
           decarboxylase|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 437

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = +2

Query: 371 DHHRYGHQVHWQTGRRRVHFDSGP--HVCRFNLFRI*GHYFASERVHYKGDY 520
           D+HR+     W   RRR HF SG    V  F   R+   +  +ERV   G Y
Sbjct: 282 DYHRFHSPTDWVVERRR-HF-SGELFSVSPFMARRLGNLFILNERVALMGRY 331


>SPBC28E12.03 |rga4||GTPase activating protein
           Rga4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 933

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%)
 Frame = +1

Query: 142 DPDNENDMLHMTVLN--SVFLNEH 207
           DPDN  D++ MTV N    FL +H
Sbjct: 904 DPDNSRDVIDMTVKNYSLAFLIDH 927


>SPBC19G7.01c |msh2|swi8, mut3, SPBC24C6.12c|MutS protein homolog
           2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 982

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +2

Query: 332 RRRGWRTQHGRFKDHHRYGHQVHWQTGRRRVHFD 433
           R+R    QH  F++H R G  +H  T  +++H +
Sbjct: 498 RQRLDELQHSIFEEHKRVGSDLHQDT-EKKLHLE 530


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,659,621
Number of Sequences: 5004
Number of extensions: 51484
Number of successful extensions: 159
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 156
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 159
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 335201398
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -