SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy...    29   0.89 
SPAC1565.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    27   2.1  
SPBC947.02 |apl2||AP-1 adaptor complex subunit Apl2 |Schizosacch...    27   2.7  
SPBC29A10.15 |orc1|orp1, cdc30|origin recognition complex subuni...    27   3.6  
SPAC17G6.17 |pof8||F-box protein Pof8|Schizosaccharomyces pombe|...    26   4.8  
SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch...    26   6.3  
SPBC30B4.05 |kap109||karyopherin Kap109|Schizosaccharomyces pomb...    26   6.3  

>SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1142

 Score = 28.7 bits (61), Expect = 0.89
 Identities = 30/112 (26%), Positives = 47/112 (41%), Gaps = 5/112 (4%)
 Frame = +2

Query: 5   EFSKISKLVALVVRKTFCNIFEINNRLVGVRVGANVQRRCGRRLTQIQHDRFASRHD--T 178
           E+S+IS   A   +K    I  +NN + G   G  +  R   ++++        R D  T
Sbjct: 620 EYSQISGQDASNAQKRIEVIVNVNN-VYGTIFGNELAYR-QEKISKFTDPSSVIRSDLWT 677

Query: 179 ADAAFFSLQRQLFVVFVSSHRPFASSKSAHLTKL---LSSQATYLYHFACLM 325
            +     L R+     +S HR    SK AH+ K+   L  Q  +L    CL+
Sbjct: 678 VEVDHLDLLRKQIEDSISLHRDVRDSKDAHILKVSNKLRKQILHLVEQNCLL 729


>SPAC1565.05 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 773

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 4/66 (6%)
 Frame = +2

Query: 311 FACLMKYKDIQKYEVQQLIEWAINASPDMDLQQ--FRIEFMDKTT--ELNLRSCQPKSFT 478
           F  L +  DI  YE+   I+ AIN+S    L+    R+   D TT  E  L +  P+ F 
Sbjct: 567 FNFLERTSDISAYEIACAIKTAINSSKVKLLRSALARLSLFDSTTSREALLLAFVPEDFD 626

Query: 479 YTFTTI 496
             F T+
Sbjct: 627 SLFKTL 632


>SPBC947.02 |apl2||AP-1 adaptor complex subunit Apl2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 683

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +2

Query: 320 LMKYKDIQKYEVQQLIEWAINASPDMDLQQFRIEFMDKTTELNLRSCQ 463
           LM  K   +  VQ+++ +AIN S + DL+     +    T  N+R  Q
Sbjct: 495 LMNGKGNDEELVQKVLNYAINQSSNQDLRDRAFAYQRLLTPENVRKAQ 542


>SPBC29A10.15 |orc1|orp1, cdc30|origin recognition complex subunit
           Orc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 707

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 13/42 (30%), Positives = 18/42 (42%)
 Frame = +3

Query: 561 SRFCHAAVENDEGAILQRIFHTTVRHVPRSLYERQRFPHLPH 686
           +RF HA+       +L       V H  + LY    +P LPH
Sbjct: 437 NRFTHASPNRSSCVVLMDELDQLVTHNQKVLYNFFNWPSLPH 478


>SPAC17G6.17 |pof8||F-box protein Pof8|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 402

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 18/88 (20%), Positives = 38/88 (43%), Gaps = 1/88 (1%)
 Frame = +2

Query: 227 VSSHRPFASSKSAH-LTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIEWAINASPDMDL 403
           + +  P  +  + H L   + S+ T   + AC   Y D +K E + +I W      +  +
Sbjct: 297 IKNLHPLTNKSTIHSLLSYVFSRQTQ--NIACEPMYIDYRKDETEAIIRWKTPLHAETCI 354

Query: 404 QQFRIEFMDKTTELNLRSCQPKSFTYTF 487
             FR +   + +  ++R+ + K  +  F
Sbjct: 355 NAFRTQERKQNSHDDIRAHRKKGSSRPF 382


>SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1318

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -3

Query: 94   DADEPIIYFENITECLTDDQCDKFTYFAELK 2
            DAD  I+   NI   LT ++CD+F Y   +K
Sbjct: 1023 DADYAIL---NILNLLTSNECDEFDYSVLMK 1050


>SPBC30B4.05 |kap109||karyopherin Kap109|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 967

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = -1

Query: 690 LNVVNEETFDVHIMIAAHGAL*YEKYVVK 604
           LN+V E+T D++I +AA  +L ++ Y+ K
Sbjct: 39  LNIVAEDTVDINIKLAA--SLYFKNYIKK 65


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,009,047
Number of Sequences: 5004
Number of extensions: 62390
Number of successful extensions: 148
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 148
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 341222980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -