SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces pomb...    29   0.67 
SPAC27D7.02c |||GRIP domain protein|Schizosaccharomyces pombe|ch...    29   0.88 
SPBC17G9.08c |csx2||Arf GAP protein|Schizosaccharomyces pombe|ch...    28   1.5  
SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|ch...    27   2.0  
SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cu...    27   2.0  
SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|...    27   3.6  
SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    26   6.2  
SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1...    25   8.2  

>SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1207

 Score = 29.1 bits (62), Expect = 0.67
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 594 KNDVGNRFEQFELRLNELDAKLNMLQSAEKLKTAIVTESKNG 719
           +ND  + F+   L LNE+++++N+L+ A     A +T   NG
Sbjct: 733 RNDTLSLFQN-SLYLNEVESRINILEQAGMYPIAYLTAKSNG 773


>SPAC27D7.02c |||GRIP domain protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 750

 Score = 28.7 bits (61), Expect = 0.88
 Identities = 14/54 (25%), Positives = 30/54 (55%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNML 668
           L    E+ +K ++   TNS+   V+ +   N++ ++ ++ +L+LNE + K   L
Sbjct: 560 LSSDYETQIKSLESSLTNSQAECVSFQEKINELNSQIDELKLKLNEANKKYQEL 613



 Score = 28.3 bits (60), Expect = 1.2
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 549 LNTNSEKFMVTHETFKNDVGNRFEQFELRLNELD-AKLNMLQSAEKLKTAIVTESKN 716
           L  NSEKF    E+ K+ V N  +      NE+D  + N+L +    +T      KN
Sbjct: 360 LKENSEKFKQNSESLKSRVDNLNDYITKLQNEIDECRRNLLWAESSCETIREENQKN 416


>SPBC17G9.08c |csx2||Arf GAP protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 870

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = +1

Query: 349 EIIFHKQKSKRDLNSLGALFATKQGLLKILMRLNFDNKSN 468
           ++ FH Q+ KRD+ +L  ++ T    L  L+   F + +N
Sbjct: 79  QLEFHAQEGKRDVTNLTCVYGTSPQQLDRLITREFSSDAN 118


>SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1822

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHE-TFKNDVGN--RFEQFELRLNELDAKLNMLQS 674
           + + IE +L  ++    +S  F+ T+  + K++V     F  F+L+L  L   L++LQS
Sbjct: 578 ISEDIEEILPSLESSERSSTPFLNTNSASLKSEVVQLTTFSDFQLKLKTLQCVLDILQS 636


>SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cuf1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 411

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 18/62 (29%), Positives = 28/62 (45%)
 Frame = +3

Query: 525 SVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKLKTAIVT 704
           + L H+  L   +      H TFK++V N    +EL  +EL A   +  S+    + I T
Sbjct: 350 AALNHISALEKETISHTDLHHTFKHEV-NSSNNYELTNDELAASSPLYTSSSVPPSHITT 408

Query: 705 ES 710
            S
Sbjct: 409 GS 410


>SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large
            subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1752

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 5/47 (10%)
 Frame = +1

Query: 385  LNSLGALFA-TKQGLLKI----LMRLNFDNKSNALLHLQTEGERDDC 510
            + S G L A T+ G+ +     LMR +F+     L+     GE+DDC
Sbjct: 1381 MTSRGHLMAITRHGINRAETGALMRCSFEETVEILMDAAASGEKDDC 1427


>SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 215

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%)
 Frame = -1

Query: 409 RTMRPTS*DRVWISACEK*FRLN--GKLDR---CPNCNQVCRRAQFQDLCKNL 266
           RT +P   D +W +AC++   +N   K  R    P C Q+C  +Q  D   NL
Sbjct: 81  RTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRC-QICVHSQRNDGDDNL 132


>SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1
           complex subunit Tpr1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1039

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%)
 Frame = -3

Query: 707 FRYDGGFQFFGR---LQHVKFGVEFVQTQFKLLK--PVAHIVLERFVGDHKFFAVCIQ 549
           + YD  FQ       +Q+    ++ +Q  FK     PVA  +LER+V   K +  CI+
Sbjct: 253 YYYDLAFQNVNNDSFVQNYGKALQHIQRAFKTRNNDPVASSILERYVYSKKNYEGCIK 310


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,551,279
Number of Sequences: 5004
Number of extensions: 48158
Number of successful extensions: 166
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 161
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 166
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 337208592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -