SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC713.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    27   2.3  
SPBC17D11.04c |||histone acetyltransferase complex subunit Nto1 ...    26   5.2  
SPAC17G8.01c |trl1|SPAC6C3.10c|tRNA ligase Trl1 |Schizosaccharom...    26   5.2  
SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|...    26   6.9  
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    26   6.9  
SPBP4H10.05c |spe2||S-adenosylmethionine decarboxylase proenzyme...    26   6.9  
SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces po...    25   9.1  

>SPBC713.09 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 395

 Score = 27.5 bits (58), Expect = 2.3
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +3

Query: 330 RASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSLTDDND 506
           +A   N  +E    ++ ND  N  N PT +    VV ++E  +ASN +++  +     D
Sbjct: 24  QAKSKNSVAEDNVDRESNDGNNQVNEPTGNDNTQVVENTEDISASNVVSAEGAEASTGD 82


>SPBC17D11.04c |||histone acetyltransferase complex subunit Nto1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 767

 Score = 26.2 bits (55), Expect = 5.2
 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%)
 Frame = +3

Query: 333 ASFDNGYSE-FCDKQQPNDYLN 395
           AS+D+   E +CDK  P DYLN
Sbjct: 348 ASYDSVDMETYCDKHTPPDYLN 369


>SPAC17G8.01c |trl1|SPAC6C3.10c|tRNA ligase Trl1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 787

 Score = 26.2 bits (55), Expect = 5.2
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%)
 Frame = -1

Query: 420 HPAWD----CYNNSNSRWAVVYHKTLNSRCRTTLGTAS 319
           H  WD    C+  + +  +V Y KT N +   TLGT+S
Sbjct: 702 HLVWDDRVICFRVTMNENSVWYGKTCNPQLHITLGTSS 739


>SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 828

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 10/40 (25%), Positives = 18/40 (45%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLN 352
           K  ++  S   ++ C +  +WDC     + WA +    LN
Sbjct: 71  KDFRIRWSAIILIHCTISQSWDCLVEHGATWAKLLIALLN 110


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +3

Query: 270 QTTMTQINFNASYTSAPTPSRASF 341
           Q +  + +FNA+   APTPS A+F
Sbjct: 869 QPSYEEESFNATVIHAPTPSTATF 892


>SPBP4H10.05c |spe2||S-adenosylmethionine decarboxylase proenzyme
           Spe2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 378

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = -1

Query: 459 LLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTAS 319
           L Q++C++L        D Y  S S   V  HK +   C TT   AS
Sbjct: 61  LAQAQCKVLSVVNSEEIDAYLLSESSMFVFAHKIILKTCGTTTLLAS 107


>SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 517

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 1/66 (1%)
 Frame = -3

Query: 637 QKIPHYKQNWAMVLRNRQLKGFRIISRTNCFSEIISGLEQTFHISLS-SVNELTLAKKFE 461
           +++P+YK +W      R L     I  +N   E+   L+     + S  VNE+ LA    
Sbjct: 22  KRLPYYKSDWIDACHYRVLPACLNIYFSNLLPELAFALDMFAKTNNSFGVNEVLLASVLG 81

Query: 460 AAAVSL 443
           +   +L
Sbjct: 82  SVVFAL 87


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,121,524
Number of Sequences: 5004
Number of extensions: 63630
Number of successful extensions: 201
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 197
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 201
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 373338084
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -