SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC12B10.09 |||S-adenosylmethionine transporter |Schizosaccharo...    31   0.13 
SPBC14C8.08c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual       30   0.39 
SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr...    28   1.2  
SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces ...    27   2.1  
SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual      27   3.6  
SPAC3C7.09 |set8||lysine methyltransferase Set8 |Schizosaccharom...    26   4.8  
SPBC725.16 |res1|sct1|MBF transcription factor complex subunit R...    26   6.3  
SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb...    26   6.3  
SPBC30D10.10c |tor1||phosphatidylinositol kinase Tor1|Schizosacc...    25   8.4  
SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom...    25   8.4  

>SPAC12B10.09 |||S-adenosylmethionine transporter
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 345

 Score = 31.5 bits (68), Expect = 0.13
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = -2

Query: 560 LRCRLKTTMSIGRPFFYHLFSVIKNEHKICQFGRVFHQIPHGR 432
           ++CR+K  M      ++ +FS +   +K+CQFGR+   I HG+
Sbjct: 20  VQCRIKEIMYWNICLYWDVFSKLIIYNKVCQFGRI--HIFHGK 60


>SPBC14C8.08c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 182

 Score = 29.9 bits (64), Expect = 0.39
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 3/100 (3%)
 Frame = +3

Query: 225 LLQQIQ-HGPAIAIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYT 401
           LL ++  HG ++ I++ L +   + I ++   +Q+  K  K KKK +N  +  + N+   
Sbjct: 82  LLHEVDYHGKSLEILDMLLQSRNSMISSLRSELQE--KNQKDKKKEVNKLEEKMTNAKEP 139

Query: 402 KIKQPEWPSSPAMWDLVKNTPELADFVFIFDHTE--KMVK 515
            +  P   +S A   +   TPE  +     DH E  K++K
Sbjct: 140 NVNVPSMKASSA---ISVETPETIESEASVDHKEASKIIK 176


>SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1471

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 3/75 (4%)
 Frame = +3

Query: 267  NFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNS---WYTKIKQPEWPSSPA 437
            + L +K  N   ++  V + + K + +K  V+ N   IL NS   W   IK+P   S P 
Sbjct: 902  SILYEKQKNLQASITEVSK-QLKSNSKKVTVLRNKLNILNNSLSKWKCLIKKPSDFSEPV 960

Query: 438  MWDLVKNTPELADFV 482
              D   N  +L   +
Sbjct: 961  SMDFTSNDEQLVQLL 975


>SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 571

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 10/54 (18%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +3

Query: 234 QIQHGPAIAIVNFLEK--KNINYILNVMPVMQDERKMSKRKKKVINNNKYILFN 389
           +++    +A++N  ++  ++IN++ +   +  ++ K +  K++V+   K +LF+
Sbjct: 435 RLRRSEIVALINTFDRLSRSINFVDDFKQIYSEQHKPASFKRRVLRRIKQLLFS 488


>SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1202

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 8/31 (25%), Positives = 19/31 (61%)
 Frame = +3

Query: 312  PVMQDERKMSKRKKKVINNNKYILFNSWYTK 404
            P++ + +K+S +  K++ +N Y   N W+ +
Sbjct: 1060 PILPNLQKLSTQYSKIVRDNDYGNVNCWFNR 1090


>SPAC3C7.09 |set8||lysine methyltransferase Set8
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 429

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query: 387 NSWYTKIKQPEWPSSPAMW-----DLVKNTPELADFVFIFDHTEKMVKKW 521
           +SW +KI  P+W  + A++     +     P LA  + + +H+ K   KW
Sbjct: 157 DSWPSKITLPKWVHADALFHSRCLESPFKDPVLAPVIDLCNHSSKSNAKW 206


>SPBC725.16 |res1|sct1|MBF transcription factor complex subunit
           Res1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 637

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 15/56 (26%), Positives = 25/56 (44%)
 Frame = +1

Query: 85  NISSRIQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQ 252
           ++SS+ +   F    ++    + EQ  S +     K  ++LN L    YN  N DQ
Sbjct: 579 SLSSKHEVDLFTAENEAAREKLVEQLCSLQAQRKQKINEILNLLSMGMYNTINTDQ 634


>SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 10/16 (62%), Positives = 14/16 (87%)
 Frame = -2

Query: 323 LHDRHYVEDIVNVLFF 276
           L+DR YVE I+++LFF
Sbjct: 253 LYDRVYVEKILDILFF 268


>SPBC30D10.10c |tor1||phosphatidylinositol kinase
            Tor1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2335

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +1

Query: 130  KSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLLLL*ISWKK 282
            K N++   E +   + A  C +  LL KLE   Y  +N D   L  + W K
Sbjct: 2055 KRNILLNLEHRMMLQMAPDCDSLTLLQKLEVFEYVMANTDGYDLYHVLWLK 2105


>SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 762

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
 Frame = +3

Query: 339 SKRKKKVINNNKYILFN-SWYTKIKQPEWP-SSPAMWDLVKNTPEL 470
           S R++ V NNN   +FN S++ KI    +   +  +WD ++N  +L
Sbjct: 232 SLRERFVDNNNSDYIFNVSYHKKIPADGFSLYTREIWDTIENNKDL 277


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,095,463
Number of Sequences: 5004
Number of extensions: 67361
Number of successful extensions: 216
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 209
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 216
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 343230174
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -