SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch...    27   3.0  
SPAC2F3.05c |||xylose and arabinose reductase |Schizosaccharomyc...    27   3.0  
SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr...    27   3.9  
SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces...    25   9.1  
SPBC3F6.03 |trr1|caf4|thioredoxin reductase Trr1|Schizosaccharom...    25   9.1  
SPBC354.07c |||oxysterol binding protein |Schizosaccharomyces po...    25   9.1  

>SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase
           Y|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1002

 Score = 27.1 bits (57), Expect = 3.0
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = +2

Query: 182 FSIYLPPQAEGGDVKLPLLYY 244
           F+ Y+PP+  GGD+ +P  +Y
Sbjct: 20  FNGYVPPEQNGGDIVVPKDFY 40


>SPAC2F3.05c |||xylose and arabinose reductase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 275

 Score = 27.1 bits (57), Expect = 3.0
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 298 RYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVS 399
           RY  + G IV+   ++PR +K +GD   +DF +S
Sbjct: 219 RYCLQRGFIVLPKSSTPRRIKENGD--VFDFEIS 250


>SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1471

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = +2

Query: 287  LVSRGMQPNMV*LS*VLILRHVELRLMEMIHHG 385
            L+S  +QPN++ L+   +L+H+  R  + + HG
Sbjct: 1285 LISSALQPNLLELTISHMLQHIGQRAFQTLIHG 1317


>SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1485

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = +1

Query: 277 ITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWD--FGVSAGFYLDATNEPWNNNYR 450
           I+ SGF++Y   +      PD  P  V  +  +  WD  F VS G +   +     +  R
Sbjct: 308 ISISGFKKYVEMYLASDTKPDEEPPRVIYEHVNDRWDVAFAVSDGQFKQVSFVNNISTIR 367

Query: 451 MGSYLN 468
            G+++N
Sbjct: 368 GGTHVN 373


>SPBC3F6.03 |trr1|caf4|thioredoxin reductase
           Trr1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 322

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = +1

Query: 322 IVVGPDTSPRGVKIDGDDSSWDFGVSA 402
           +++    S R + I G+D+ W  G+SA
Sbjct: 115 VILATGASARRLHITGEDTYWQAGISA 141


>SPBC354.07c |||oxysterol binding protein |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 399

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = -1

Query: 497 AFKIKSYNSTFK*L-PIL*LLFHGSFVASK*KPALTPKSHDESSP 366
           A + K+Y +  K L PIL  LF+GS+ +SK K  LT +      P
Sbjct: 98  ASRNKNYGTEKKPLNPILGELFYGSWDSSKGKVELTAEQVSHHGP 142


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,414,415
Number of Sequences: 5004
Number of extensions: 74510
Number of successful extensions: 190
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 182
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 190
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 371330890
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -