SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC29A3.13 |||PWWP domain protein|Schizosaccharomyces pombe|chr...    29   0.63 
SPAC7D4.04 |taf1||Taz1 interacting factor 1|Schizosaccharomyces ...    29   0.83 
SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pom...    28   1.4  
SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy...    27   3.3  
SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ...    26   4.4  
SPAC8F11.05c |mug130||sequence orphan|Schizosaccharomyces pombe|...    26   5.8  
SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyce...    26   5.8  
SPBC215.15 |sec13||COPII-coated vesicle component Sec13|Schizosa...    26   5.8  
SPBC428.05c |arg12||argininosuccinate synthase |Schizosaccharomy...    25   7.7  

>SPBC29A3.13 |||PWWP domain protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 359

 Score = 29.1 bits (62), Expect = 0.63
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = -1

Query: 407 IAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVE 288
           IAK  G+SKRK+    + YE++K P    DL + S T+ E
Sbjct: 116 IAKFLGSSKRKSKELIEAYEASKTPP---DLKEESSTDEE 152


>SPAC7D4.04 |taf1||Taz1 interacting factor 1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 926

 Score = 28.7 bits (61), Expect = 0.83
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 71  EFEFILSKSSMVNLNLLNSKLDVFVLIVDRNLL 169
           E + +L     +N  +LNS+ DV + ++D+NLL
Sbjct: 40  EAKLLLPNGMSLNETVLNSESDVVIYVLDQNLL 72


>SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 703

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 14/49 (28%), Positives = 25/49 (51%)
 Frame = -1

Query: 446 ALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSI 300
           +L NF++DNC ++   +   S R N   S+   S      D+DL  +++
Sbjct: 223 SLANFQSDNCKLKSHNSL-PSIRTNVRYSNSKPSTPLSPEDVDLGTYTV 270


>SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 800

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +2

Query: 545 GNACVISFSDHKLHFVSKISNK 610
           G+AC +S  + K+H ++ ISN+
Sbjct: 230 GSACAVSDDEGKIHVINDISNE 251


>SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 3655

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -3

Query: 246  YLHYYIFKNYGVFEYCKSLTDHSLFTN 166
            +L  Y+ K YG+  YC  L ++SL  N
Sbjct: 2483 HLLVYLSKTYGLHHYCILLLENSLQNN 2509


>SPAC8F11.05c |mug130||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 241

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 3/32 (9%)
 Frame = -2

Query: 637 AFIHNRFHPLV---TNFTNKMEFVVTETNDTS 551
           AFI N++ PLV   T++TN     V +TN  S
Sbjct: 112 AFIENKYSPLVFHATSWTNGFSIDVQKTNPIS 143


>SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 642

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 6/65 (9%)
 Frame = -1

Query: 464 REFDTEALVNFENDNCNVRIAK------TFGASKRKNTTRSDDYESNKQPDYDMDLSDFS 303
           R+  TE      + N  V++AK      +F   K+KNTT S   ES+     D    D S
Sbjct: 6   RKESTEVKKKDGSMNKRVKVAKLPKKVDSFSPKKKKNTTSSGSSESDSMSQNDKK-KDSS 64

Query: 302 ITEVE 288
           + E E
Sbjct: 65  LNESE 69


>SPBC215.15 |sec13||COPII-coated vesicle component
           Sec13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 297

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 542 SGNACVISFSDHKLHFVSKISNKW 613
           SGN   +S  D+K++   +  NKW
Sbjct: 266 SGNILAVSCGDNKVYLFKESQNKW 289


>SPBC428.05c |arg12||argininosuccinate synthase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 410

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +3

Query: 582 SILLVKLVTSGWNLLCIKANV 644
           S +L  L+  GW ++C  ANV
Sbjct: 19  SCILAWLIEEGWEVICYMANV 39


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,421,428
Number of Sequences: 5004
Number of extensions: 47060
Number of successful extensions: 163
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 163
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 315915086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -