SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomy...    31   0.13 
SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting pro...    27   3.6  
SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo...    26   6.3  
SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac...    26   6.3  

>SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 523

 Score = 31.5 bits (68), Expect = 0.13
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 402 SLRENVNNQLHARDASQLHLLDWENFMGEFSSYFGLTHTTCSISNI*QLTYLLNKH-SYF 578
           +L E    QLH+RD  ++ L   +N +GEF  Y  +++    I ++ Q +   + H +Y 
Sbjct: 252 ALYEKDREQLHSRDWKKIQLAKTQNDLGEFLDYI-ISNYKVPIESLNQPSDQYSFHDAYL 310

Query: 579 NNWRQLYP 602
            ++   YP
Sbjct: 311 QSYTHRYP 318


>SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting
           protein 3 homolog Bud6|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1385

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +3

Query: 330 RNPNKYKRYSELIARQSEAGGASASLRENVNNQLHARDASQL-HLL-DWENFMGEFSSYF 503
           RNP+  K+Y E  +    A GA  +L++   N L  R + +L H++ D +N  G   +  
Sbjct: 213 RNPDSRKQYEETTSASLSAPGAFDALKQ--TNALERRASKRLSHMVKDQQNNEGSSQNLR 270

Query: 504 GLT 512
            +T
Sbjct: 271 NIT 273


>SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit
           Swi2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 722

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 14/55 (25%), Positives = 27/55 (49%)
 Frame = +1

Query: 52  IVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPN 216
           +++ + S+    + +     N+VL+     +N  N+I  NT  + I+ N  N PN
Sbjct: 463 VLNENNSKNRTNVTKPNSYKNSVLSIGNNHSNHSNIIKPNTYKNTILSNENNTPN 517


>SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 848

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +3

Query: 327 VRNPNKYKRYSELIARQSEAGGASASL 407
           V NP K KR  EL  + SE+G   ++L
Sbjct: 324 VNNPKKRKRALELALKGSESGSPDSTL 350


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,810,470
Number of Sequences: 5004
Number of extensions: 55952
Number of successful extensions: 178
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 173
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 177
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 341222980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -