SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc...    33   0.047
SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch...    29   1.0  
SPAC24C9.05c |mug70||conserved protein |Schizosaccharomyces pomb...    26   5.5  
SPAC2F7.04 |pmc2|med1|RNA polymerase II holoenzyme mediator comp...    26   7.2  
SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy...    26   7.2  
SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr 3|||Ma...    26   7.2  

>SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin
           homolog|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 997

 Score = 33.1 bits (72), Expect = 0.047
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = +2

Query: 578 RGDETVCFFCDCCVRDWHINEDAWQRHATENPQC--YFVLSVK 700
           R D   C+ C     DW  ++D  + H T +P C   ++LS K
Sbjct: 62  RLDNVTCYMCTKSFYDWEDDDDPLKEHITHSPSCPWAYILSSK 104



 Score = 31.5 bits (68), Expect = 0.14
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 276 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYA 380
           D+V C  C     +W +D+     H+T SP C +A
Sbjct: 64  DNVTCYMCTKSFYDWEDDDDPLKEHITHSPSCPWA 98



 Score = 31.5 bits (68), Expect = 0.14
 Identities = 10/34 (29%), Positives = 15/34 (44%)
 Frame = +2

Query: 584 DETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           D   C +CD  + DW  ++D +  H      C F
Sbjct: 159 DAAHCLYCDINLHDWEPDDDPYTEHKRRRADCVF 192


>SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit
           Rev3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1480

 Score = 28.7 bits (61), Expect = 1.0
 Identities = 13/51 (25%), Positives = 25/51 (49%)
 Frame = -3

Query: 445 SFTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAYSIHSSSDQFFISASQY 293
           SF S  ++V+ S  +  + ++    Q    + C Y +H+SS  + I  + Y
Sbjct: 711 SFPSCTVLVVNSELELINEVIGLNRQLDPTIVCGYEVHNSSWGYLIERASY 761


>SPAC24C9.05c |mug70||conserved protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 730

 Score = 26.2 bits (55), Expect = 5.5
 Identities = 14/38 (36%), Positives = 17/38 (44%)
 Frame = -3

Query: 454 GLPSFTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAY 341
           G PSF   AL  ++ P DS S I     Q   + T  Y
Sbjct: 542 GNPSFVEQALQDLVQPTDSASQIFPLNPQSPSQFTIKY 579


>SPAC2F7.04 |pmc2|med1|RNA polymerase II holoenzyme mediator complex
           subunit |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 454

 Score = 25.8 bits (54), Expect = 7.2
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +1

Query: 142 FRDNIAEHVFDMLLERHGSFENYPIVNTALINSLIVNGLNTIKSTITL 285
           F DN++      LL  +    + PI+ ++ IN  + N L  I +T+ L
Sbjct: 209 FMDNLSHESLPHLLFGYNLLNSPPILQSSKINWALENTLTPIPTTMEL 256


>SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 654

 Score = 25.8 bits (54), Expect = 7.2
 Identities = 18/76 (23%), Positives = 32/76 (42%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAVLV 440
           ++ + D +  E  E  ++ + E E I+Y     S + AY N I+      + + I+ +  
Sbjct: 504 FSHISDSLTTEELELILRQYGEIESIKYLKNRSSGFVAYTN-ISNAMKAVNGLPIHPLFK 562

Query: 441 KEGRPKCVYRCMSNLQ 488
           K        RC   LQ
Sbjct: 563 KSKIRYAPDRCEQELQ 578


>SPCC553.08c |||GTPase Ria1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1000

 Score = 25.8 bits (54), Expect = 7.2
 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 1/77 (1%)
 Frame = +1

Query: 235 NSLIVNGL-NTIKSTITLCASIVKQK*KIGPKTSVLNMHT*PCRRIARMPTRLLSTNRLA 411
           N   + GL  T+  T TLC+S        GP    +     P  R+A  P R    N+L 
Sbjct: 527 NVFAIGGLAGTVLRTATLCSS------PNGPNLVGVTQQMEPIVRVALEPVRPFEMNKLV 580

Query: 412 TTLPSTLY**KKADPSV 462
           T L        +ADP V
Sbjct: 581 TGLDML----NQADPCV 593


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,130,455
Number of Sequences: 5004
Number of extensions: 65757
Number of successful extensions: 215
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 203
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 215
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 390427050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -