SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC23E6.02 |||ATP-dependent DNA helicase |Schizosaccharomyces p...    62   9e-11
SPBC582.10c |||ATP-dependent DNA helicase Rhp16b |Schizosaccharo...    62   9e-11
SPAC15A10.03c |rhp54|rad54|Rad54 homolog Rhp54|Schizosaccharomyc...    55   1e-08
SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyce...    54   3e-08
SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces po...    52   9e-08
SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch...    49   9e-07
SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase Rdh54...    48   2e-06
SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizo...    47   4e-06
SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22...    42   1e-04
SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosacc...    42   1e-04
SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|...    39   7e-04
SPAC20G8.08c |fft1||fun thirty related protein Fft1|Schizosaccha...    38   0.002
SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|...    38   0.002
SPCC1235.05c |fft2||fun thirty related protein Fft2|Schizosaccha...    37   0.003
SPAC1783.05 |hrp1|chd1|ATP-dependent DNA helicase Hrp1|Schizosac...    36   0.007
SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizo...    36   0.007
SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo...    33   0.035
SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharo...    33   0.047
SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom...    28   1.3  
SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schiz...    26   7.1  
SPAC4C5.03 |||CTNS domain protein |Schizosaccharomyces pombe|chr...    26   7.1  
SPAC27F1.08 |pdt1||Nramp family manganese ion transporter|Schizo...    26   7.1  
SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual    26   7.1  
SPAC29E6.06c ||SPAC30.10c|cysteine-tRNA ligase |Schizosaccharomy...    25   9.4  
SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula...    25   9.4  

>SPBC23E6.02 |||ATP-dependent DNA helicase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1040

 Score = 62.1 bits (144), Expect = 9e-11
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSD-DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            +++ + + V +I+     DKI++ SQ+V +L++F   F+Q+ I  LMYTG L   +R   
Sbjct: 866  KIEKALNAVKEIIKKQPTDKILIFSQFVSFLELFTVPFRQEGIKYLMYTGGLSTAER--N 923

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +   N   D   R+LL+S+K G VGLNL   N
Sbjct: 924  QALINFEVDPNVRVLLISLKAGNVGLNLTCAN 955



 Score = 47.2 bits (107), Expect = 3e-06
 Identities = 25/77 (32%), Positives = 46/77 (59%), Gaps = 11/77 (14%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNK-------NNDSTN--- 155
           L +T RWC++GTP+ N   + YS+I FL+ +P++D   W   +K       +N +T+   
Sbjct: 558 LESTYRWCLSGTPMQNGVEEFYSLIKFLRIKPYSD---WSSFSKDFTIPLSSNINTSAPM 614

Query: 156 -RIKSIIKKIVLKRDKS 203
            R + ++K ++L+R K+
Sbjct: 615 KRFRGLLKAVLLRRTKN 631



 Score = 35.9 bits (79), Expect = 0.007
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +2

Query: 377 VLWLILKLRQICCHPYLAMHGRNLLETNDCFK 472
           +L L+L+LRQ CCHP+L +     ++ ND F+
Sbjct: 689 LLVLLLRLRQACCHPWLIVAREAAVDDNDSFQ 720



 Score = 27.1 bits (57), Expect = 3.1
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +3

Query: 102 FNDPRVWKMLNKNNDSTNRIKSIIKK 179
           F DP+ W    K   + N +K IIKK
Sbjct: 855 FTDPKHWTTSTKIEKALNAVKEIIKK 880


>SPBC582.10c |||ATP-dependent DNA helicase Rhp16b
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 830

 Score = 62.1 bits (144), Expect = 9e-11
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 7/82 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-------MLNKNNDSTNRI 161
           AL   NRWC+TGTP+ N   ++YS++ FL   PFND  VWK          + N    R+
Sbjct: 402 ALQGINRWCLTGTPLQNNVDELYSLVKFLHINPFNDQSVWKDQISLPLCQGEENLVFKRL 461

Query: 162 KSIIKKIVLKRDKSEISFNIPK 227
           + ++  I+L+R K+ +  N  K
Sbjct: 462 RMLLSVIMLRRTKTLLEANAGK 483



 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K I+ SQ+  +L I +   ++  I  + Y G++    R  +     + + TQ  +LL S+
Sbjct: 672 KTIIFSQFTTFLDIIDLHLRKAGIGFVRYDGRMNNRAREKSLDLLRSDSGTQ--VLLCSL 729

Query: 724 KCGGVGLNL 750
           KCG +GLNL
Sbjct: 730 KCGALGLNL 738



 Score = 28.3 bits (60), Expect = 1.3
 Identities = 18/58 (31%), Positives = 25/58 (43%)
 Frame = +2

Query: 248 C*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHP 421
           C F E E+  Y  L    E      V      N+    +   ++L L+L+LRQ C HP
Sbjct: 502 CKFEESERDFYSNLARNMERTMSNFV------NSGKLGKNYTNILCLLLRLRQACNHP 553


>SPAC15A10.03c |rhp54|rad54|Rad54 homolog Rhp54|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 852

 Score = 55.2 bits (127), Expect = 1e-08
 Identities = 30/82 (36%), Positives = 42/82 (51%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
           I   +DDKI+L+S +   L +FE   + +    L   G + V  R     TFN+  +   
Sbjct: 622 IKQETDDKIVLISNYTSTLDLFEQLCRARGYKALRLDGTMNVNKRQRLVDTFND-PEKDA 680

Query: 703 RILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG G+NLIG N L
Sbjct: 681 FVFLLSSKAGGCGINLIGANRL 702


>SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1418

 Score = 53.6 bits (123), Expect = 3e-08
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L T   +I+L SQ+++ L I E++F+ KNIA   + G     +R  A  +F NA +++  
Sbjct: 883  LITRGHRILLFSQFIQQLDILEDWFEYKNIAYARFDGASSEMERQSAIDSF-NAPNSELS 941

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GGVG+NL   +T+
Sbjct: 942  CFLLSTRAGGVGINLASADTV 962



 Score = 36.7 bits (81), Expect = 0.004
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN-KNNDSTNRIKSIIKKIVLKRDKSE 206
           +TGTP+ N   ++++++ FL     N   + K  +  + +    +  I+K   L+R KSE
Sbjct: 716 LTGTPLQNNVRELFNLLQFLNPMKINAAELEKRYSIIDTEKVTELHQILKPFFLRRVKSE 775

Query: 207 ISFNIP 224
           +  N P
Sbjct: 776 VLDNFP 781


>SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 897

 Score = 52.0 bits (119), Expect = 9e-08
 Identities = 29/89 (32%), Positives = 49/89 (55%)
 Frame = +1

Query: 496 QTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETT 675
           Q    ++D I +  ++KI++ SQ+ +YL +  +  K +NI  + Y G +    R  +  +
Sbjct: 727 QARQTILDIIGSKRNEKILVYSQFSQYLCLVSHMLKLENIRHVRYDGTMSANQRQKSLHS 786

Query: 676 FNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           FNN  D    ++L+S+K G VGLNL   N
Sbjct: 787 FNNDKDV--LVMLVSLKAGSVGLNLTIAN 813



 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 18/107 (16%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN-------------ND 146
           L A  RWC++GTPI N   + YS++ FL+ +P+    VW +  K+               
Sbjct: 416 LDAKYRWCLSGTPIQNHIDEFYSLLKFLRIKPYC---VWSLFAKDISRPLKSYRADIVEA 472

Query: 147 STNRIKSIIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKK 272
           +  R++ ++   V +R K + ++     N+P  T+  V VNL+ +++
Sbjct: 473 ALKRLRILLASTVFRRTKETRVNNLPIVNLPPKTIRTVSVNLLPEER 519



 Score = 29.1 bits (62), Expect = 0.76
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 359 LQQMQHVLWLILKLRQICCHPYL 427
           L +   +L  +L+LRQ CCHP+L
Sbjct: 543 LSRYGFLLVSLLRLRQFCCHPWL 565


>SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1133

 Score = 48.8 bits (111), Expect = 9e-07
 Identities = 26/73 (35%), Positives = 47/73 (64%), Gaps = 7/73 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK----MLNKNND---STNRI 161
           ++++ NRW ITGTPI NK  D+YS+I F++  P+ +   W+    +  ++ D   + N +
Sbjct: 674 SISSQNRWVITGTPIVNKLDDLYSLIKFMRYEPWCNYTYWQTFVSLPYQSKDVLKALNVV 733

Query: 162 KSIIKKIVLKRDK 200
           +SI++ +VL+R K
Sbjct: 734 QSILEFLVLRRTK 746



 Score = 47.2 bits (107), Expect = 3e-06
 Identities = 23/78 (29%), Positives = 42/78 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            ++  +K+++ SQ+  +L I  +  + + +    + G +  + R  A  TF N  D    +
Sbjct: 978  SSEPEKVVIFSQFTTFLDIIADVLESEKMGYARFDGTMSQQMRSTALETFRNDPDVN--V 1035

Query: 709  LLLSIKCGGVGLNLIGGN 762
            L++S+K GGVGLNL   N
Sbjct: 1036 LIISLKAGGVGLNLTCAN 1053



 Score = 33.9 bits (74), Expect = 0.027
 Identities = 23/73 (31%), Positives = 36/73 (49%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           F++ E+ +YD L  +++      + A     TL R      +L L+L+LRQ CC P L  
Sbjct: 771 FSDSERKIYDSLYTKAKSTVNANIVA----GTLFR--NYTTILGLLLRLRQACCDPVLLS 824

Query: 434 HGRNLLETNDCFK 472
           +     ET D F+
Sbjct: 825 NMTINSETFDDFE 837


>SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase
           Rdh54|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 811

 Score = 48.0 bits (109), Expect = 2e-06
 Identities = 26/75 (34%), Positives = 38/75 (50%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++VSQ+ E L++ E F    ++      G     +R L    FN ++  +  +LLLS 
Sbjct: 550 KAVIVSQYKETLELIELFLSILHVRFCKLLGSTPFSERDLIVHNFNTSSFKEFSVLLLSS 609

Query: 724 KCGGVGLNLIGGNTL 768
           K GG GLNL G   L
Sbjct: 610 KAGGCGLNLTGSTRL 624



 Score = 28.7 bits (61), Expect = 1.0
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK 125
           L    R  +TGTP+ N   + +SM+NF+       P  +K
Sbjct: 361 LKTRKRLLLTGTPLQNDLSEYFSMVNFIIPGSLGTPNSFK 400


>SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase
            Swr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1288

 Score = 46.8 bits (106), Expect = 4e-06
 Identities = 26/93 (27%), Positives = 48/93 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q    L+ D+++    ++++ +Q  + L I E F        L   G  K+E R +  
Sbjct: 992  KLQVLDRLLKDLVSNGH-RVLIFTQMTKVLDILEQFLNIHGHRYLRLDGATKIEQRQILT 1050

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FNN  D +  + +LS + GG+G+NL G +T+
Sbjct: 1051 ERFNN--DDKIPVFILSTRSGGLGINLTGADTV 1081



 Score = 26.2 bits (55), Expect = 5.4
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFL 89
           A +R  +TGTP+ N   +++S++ FL
Sbjct: 596 AEHRLLLTGTPLQNNLVELWSLLYFL 621


>SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase
            Snf22|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1680

 Score = 41.9 bits (94), Expect = 1e-04
 Identities = 23/75 (30%), Positives = 38/75 (50%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K ++  Q  + + I E++ + KN   L   G  K +DR      FN+     + I +LS 
Sbjct: 1205 KTLMFFQMTQIMTIMEDYLRSKNWKYLRLDGSTKSDDRCSLLAQFNDPKSDVY-IFMLST 1263

Query: 724  KCGGVGLNLIGGNTL 768
            + GG+GLNL   +T+
Sbjct: 1264 RAGGLGLNLQTADTV 1278



 Score = 27.5 bits (58), Expect = 2.3
 Identities = 10/29 (34%), Positives = 20/29 (68%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFN 107
            R  +TGTP+ N   ++++++NF+  + FN
Sbjct: 1021 RLILTGTPLQNNLPELWALLNFVLPKIFN 1049


>SPAC25A8.01c ||snf2SR|fun thirty related protein
           Fft3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 922

 Score = 41.9 bits (94), Expect = 1e-04
 Identities = 25/74 (33%), Positives = 37/74 (50%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           D+++L SQ+ + L I +   K  N+  L + G  +V+ R      F   AD    + LLS
Sbjct: 778 DRVVLFSQFTQVLDILQLVMKSLNLKFLRFDGSTQVDFRQDLIDQFY--ADESINVFLLS 835

Query: 721 IKCGGVGLNLIGGN 762
            K GG G+NL   N
Sbjct: 836 TKAGGFGINLACAN 849


>SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase
           Snf21|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1199

 Score = 39.1 bits (87), Expect = 7e-04
 Identities = 22/78 (28%), Positives = 38/78 (48%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S  +I++  Q  + + I E++   +    L   G  K +DR      FN+    +  + L
Sbjct: 751 SGHRILMFFQMTQIMNIMEDYLHYRQWRYLRLDGSTKADDRSKLLGVFNDPT-AEVNLFL 809

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS + GG+GLNL   +T+
Sbjct: 810 LSTRAGGLGLNLQTADTV 827



 Score = 28.7 bits (61), Expect = 1.0
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFN 107
           R  +TGTP+ N   ++++++NF+  R FN
Sbjct: 569 RLILTGTPLQNNLPELWALLNFVLPRIFN 597


>SPAC20G8.08c |fft1||fun thirty related protein
           Fft1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 944

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           +++I++ SQ+ + L I E      ++  L   G   VE R      F+   +  +++ LL
Sbjct: 780 NERILIFSQFTQVLDILEYVLNTLDLEFLRLDGSTPVETRQQLIDDFHT--NENYKVFLL 837

Query: 718 SIKCGGVGLNLIGGN 762
           S K GG G+NL   N
Sbjct: 838 STKSGGFGINLTCAN 852



 Score = 28.7 bits (61), Expect = 1.0
 Identities = 23/99 (23%), Positives = 48/99 (48%), Gaps = 17/99 (17%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR-----VWKMLNKNN--------- 143
           + A  R  ITGTP+ N   ++ S++ F+  + F++       ++K+   ++         
Sbjct: 562 IPANFRLLITGTPLQNNLKELISLLAFMLPKVFDNNMQGLDIIYKIKTTSDGDIERAYLS 621

Query: 144 -DSTNRIKSIIKKIVLKRDKSEISFNIPK--HTVEYVHV 251
            +  +R K+I+   +L+R K  +  ++P     VEY H+
Sbjct: 622 QERISRAKTIMNPFILRRRKENVLSDLPPKIQHVEYCHM 660


>SPBC1826.01c |mot1||TATA-binding protein associated factor
            Mot1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1953

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHR 705
            S+ ++++  Q  + L + E    Q  +  + Y    G ++   R  A T FNN  D    
Sbjct: 1735 SEHRVLIFCQLKDMLDMVEKDLLQATMPDVTYMRLDGSVEPTKRQEAVTKFNN--DPSID 1792

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            +LLL+   GG+GLNL G +T+
Sbjct: 1793 VLLLTTHVGGLGLNLTGADTV 1813


>SPCC1235.05c |fft2||fun thirty related protein
            Fft2|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1284

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 24/75 (32%), Positives = 35/75 (46%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            +I+L SQ+ + L I E       I+ +   G  +VE R      F+   D    + LLS 
Sbjct: 942  RILLFSQFTQMLDILEQVLDTLKISYVRLDGSTQVEVRQDIIDQFHKEEDVT--VFLLST 999

Query: 724  KCGGVGLNLIGGNTL 768
            K GG G+NL   N +
Sbjct: 1000 KAGGFGINLACANVV 1014


>SPAC1783.05 |hrp1|chd1|ATP-dependent DNA helicase
           Hrp1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1373

 Score = 35.9 bits (79), Expect = 0.007
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPF--NDPRVWKMLNKNNDSTNR-IKSIIKKIVL 188
           NR  ITGTP+ N   ++ S++NFL    F   D   +   N   +   R ++  ++  +L
Sbjct: 547 NRLLITGTPLQNNLKELASLVNFLMPGKFYIRDELNFDQPNAEQERDIRDLQERLQPFIL 606

Query: 189 KRDKSEISFNIPKHTVEYVHVNL 257
           +R K ++  ++P  +   + V L
Sbjct: 607 RRLKKDVEKSLPSKSERILRVEL 629



 Score = 33.9 bits (74), Expect = 0.027
 Identities = 20/75 (26%), Positives = 36/75 (48%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           ++++ SQ V  L I   +   +        G +    R ++   FN A D+   + LLS 
Sbjct: 722 RVLIFSQMVRMLNILGEYMSLRGYNYQRLDGTIPASVRRVSIDHFN-APDSPDFVFLLST 780

Query: 724 KCGGVGLNLIGGNTL 768
           + GG+G+NL   +T+
Sbjct: 781 RAGGLGINLNTADTV 795


>SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog
           Rhp16|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 963

 Score = 35.9 bits (79), Expect = 0.007
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPF 104
           L  T + C++GTP+ N+  +++S++ FL+  PF
Sbjct: 514 LRTTRKICLSGTPLQNRIGELFSLLRFLRADPF 546



 Score = 29.5 bits (63), Expect = 0.57
 Identities = 20/69 (28%), Positives = 31/69 (44%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQ+   L +     ++     +   G +  + R      F+N  D    I L+S+
Sbjct: 812  KSIVFSQFTSMLDLIHWRLRKAGFNCVKLDGGMTPKARAATIEAFSN--DINITIFLVSL 869

Query: 724  KCGGVGLNL 750
            K GGV LNL
Sbjct: 870  KAGGVALNL 878



 Score = 29.1 bits (62), Expect = 0.76
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           FNEEE+ +Y  L  +S+  +   +A    E  +  L    ++  LI ++RQ+  HP L +
Sbjct: 641 FNEEEEDVYQSLYMDSKRKFNTYLA----EGVV--LNNYANIFQLITRMRQMADHPDLVL 694


>SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase
            Ino80|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1604

 Score = 33.5 bits (73), Expect = 0.035
 Identities = 18/81 (22%), Positives = 36/81 (44%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +D ++++  Q    + + E +   +    L   G  K+  R    T +    +    
Sbjct: 1441 LKANDHRVLIYFQMTRMIDLMEEYLTFRQYKYLRLDGSSKISQRRDMVTEWQTRPELF-- 1498

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1499 VFLLSTRAGGLGINLTAADTV 1519



 Score = 32.7 bits (71), Expect = 0.062
 Identities = 23/103 (22%), Positives = 46/103 (44%), Gaps = 13/103 (12%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPRVW----------KMLNKNN 143
            A    NR  +TGTPI N   +++++++F+    F   N+   W               N 
Sbjct: 995  AFKCRNRLLLTGTPIQNTMQELWALLHFIMPSLFDSHNEFSEWFSKDIESHAQSNTQLNE 1054

Query: 144  DSTNRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
                R+  I+K  +L+R K  +   + +   + V+ +L +++K
Sbjct: 1055 QQLKRLHMILKPFMLRRVKKNVQSELGEKIEKEVYCDLTQRQK 1097


>SPAC3G6.01 |hrp3||ATP-dependent DNA helicase
           Hrp3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1388

 Score = 33.1 bits (72), Expect = 0.047
 Identities = 19/84 (22%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +3

Query: 15  TNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSI---IKKIV 185
           +NR  ITGTP+ N   ++ ++++FL    F       +   + +    I+S+   ++  +
Sbjct: 530 SNRLLITGTPLQNNIRELAALVDFLMPGKFEIREEINLEAPDEEQEAYIRSLQEHLQPYI 589

Query: 186 LKRDKSEISFNIPKHTVEYVHVNL 257
           L+R K ++  ++P  +   + V L
Sbjct: 590 LRRLKKDVEKSLPSKSERILRVEL 613



 Score = 32.7 bits (71), Expect = 0.062
 Identities = 20/81 (24%), Positives = 38/81 (46%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ V  L I  ++   +        G +    R  +   FN A ++   
Sbjct: 702 LRRDGHRVLIFSQMVRMLDILGDYLSLRGYPHQRLDGTVPAAVRRTSIDHFN-APNSPDF 760

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+G+NL+  +T+
Sbjct: 761 VFLLSTRAGGLGINLMTADTV 781


>SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1375

 Score = 28.3 bits (60), Expect = 1.3
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +1

Query: 502  SAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLK 645
            S HL+    N    K+++ SQW++ L +    F+   I  + + G+ K
Sbjct: 1192 SKHLLYLKHNELYPKVVVFSQWLDVLDVLHKSFEANGIVFIRFDGKSK 1239



 Score = 26.6 bits (56), Expect = 4.0
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +2

Query: 383 WLILKLRQICCHPYLAMHGRN 445
           WL+ +LRQ CCHP +    ++
Sbjct: 570 WLV-RLRQACCHPQVGFGNKS 589



 Score = 25.8 bits (54), Expect = 7.1
 Identities = 8/28 (28%), Positives = 18/28 (64%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRP 101
           N W ++GTP+ ++  D++ ++  L+  P
Sbjct: 450 NCWTVSGTPVRSEVDDLFGLLFLLRYSP 477


>SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1253

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +1

Query: 568 VEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           V+YL +F    K +N+ T MY+   K + +  + TT +N  +   +I+
Sbjct: 727 VDYLDLFLTSLKPENVTTGMYSDTSKSQSQ-QSVTTIDNKVNLLCKII 773


>SPAC4C5.03 |||CTNS domain protein |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 302

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -2

Query: 671 VSAKILSSTFNWPVYINVAMFFC 603
           +SA +LSS F W  ++  +  FC
Sbjct: 173 LSATVLSSNFAWAAFLGFSASFC 195


>SPAC27F1.08 |pdt1||Nramp family manganese ion
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 521

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 13/50 (26%), Positives = 28/50 (56%)
 Frame = -3

Query: 196 SRFKTIFLIILFMRFVESLFLFNIFHTLGSLKGRHCKKLIIEYISQCLLW 47
           SRF+   L I+F+  + +++L ++   LGS+ G    +   E+ ++ + W
Sbjct: 99  SRFQYKLLFIVFLSNLFAVYLQSLCIRLGSVTGMDLARNCREHYNRYICW 148


>SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 545

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +3

Query: 204 EISFNIPKHTVEYVHVNLMKKKKR 275
           EI F+IP HT   VH N+ K   R
Sbjct: 419 EIQFSIPPHTNLIVHFNVEKTPLR 442


>SPAC29E6.06c ||SPAC30.10c|cysteine-tRNA ligase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 754

 Score = 25.4 bits (53), Expect = 9.4
 Identities = 7/17 (41%), Positives = 13/17 (76%)
 Frame = +2

Query: 656 GFWPRRHSIMLPILNIE 706
           GFWP+   +++P+L+ E
Sbjct: 191 GFWPKVQDVLVPLLDAE 207


>SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator
           protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1400

 Score = 25.4 bits (53), Expect = 9.4
 Identities = 10/35 (28%), Positives = 17/35 (48%)
 Frame = -1

Query: 468 KQSFVSKRFLPCMAKYGWQQICLNFSISHNTCCIC 364
           + S V   ++ C+A  G ++I  +       CCIC
Sbjct: 571 QSSSVWSTYIKCLASAGQKEIKRSVETGRAICCIC 605


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,258,227
Number of Sequences: 5004
Number of extensions: 67746
Number of successful extensions: 284
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 239
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 277
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 383374054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -