SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo...    30   0.30 
SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb...    29   0.68 
SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schiz...    28   1.6  
SPBC1709.20 |pop8||RNase P and RNase MRP subunit Pop8 |Schizosac...    28   1.6  
SPBC1778.06c |fim1||fimbrin|Schizosaccharomyces pombe|chr 2|||Ma...    27   2.1  
SPCC777.13 |vps35||retromer complex subunit Vps35|Schizosaccharo...    27   3.6  
SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p...    26   4.8  
SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces...    25   8.4  
SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc...    25   8.4  
SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy...    25   8.4  

>SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase
           Ino80|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1604

 Score = 30.3 bits (65), Expect = 0.30
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
 Frame = +1

Query: 13  ERGNFYYNTPPPPLRY--PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSV 186
           +RGN +  +PPPPL Y  P   AT    NA   NNA      TT  N  +   ++ ++ +
Sbjct: 55  QRGNEFQASPPPPLGYVTPEYGATGTPVNA---NNASRVDYATTAANVPEEYANDYSSEL 111

Query: 187 AIAPYNKSKEPTLD 228
           A   +N +  P +D
Sbjct: 112 AYI-HNVNDMPHVD 124


>SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 504

 Score = 29.1 bits (62), Expect = 0.68
 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 1/87 (1%)
 Frame = +1

Query: 67  NPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE-PTLDAGESI 243
           +P T +        + P  V     DN M       T        NK      LDA ES 
Sbjct: 418 DPETNLIAGLAPLKDTPVMVMGVESDNLMPVECQRETARCLEKAGNKQVVYHELDANESF 477

Query: 244 WYNNVWILFKKLLDITGAMTCQNLVLS 324
           + ++ +++++K LD+ G    + L LS
Sbjct: 478 YGHDTFLIYRKDLDLVGGKLKKFLELS 504


>SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1253

 Score = 27.9 bits (59), Expect = 1.6
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = +3

Query: 147  QNGHEPQQQHKLGSDRTV-QQEQRTDARRRRIYLVQQCVDFVQKIIR-YYRCNDMSELSP 320
            +N    +++   G   TV ++E   ++ RR I  V++    V +++    RCN  ++ S 
Sbjct: 1141 KNNRRLERKRARGKKGTVFEEEYLVNSLRRLIARVEEIRPEVHRLLEALVRCNMTTQASE 1200

Query: 321  LMIHFINTIRDMCIDTNPINVNVVKRFES 407
            L  +F N I  +     PI    V  FE+
Sbjct: 1201 LQRNFANVIGTIGEKVIPILSVPVSTFET 1229


>SPBC1709.20 |pop8||RNase P and RNase MRP subunit Pop8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 108

 Score = 27.9 bits (59), Expect = 1.6
 Identities = 17/59 (28%), Positives = 27/59 (45%)
 Frame = +3

Query: 402 ESEETMIRHLIRLQKELGQGNAAESLPSDSNIFQASLC*IRCRRTRKNFTTVALICWVK 578
           E ++  +RHLI L      G    ++P D    Q+    +RC +  K    VAL  +V+
Sbjct: 27  EIDDISLRHLITLALNQSFGIFGSAIPIDFLHRQSKFLYLRCHKEDKKKVLVALGSYVR 85


>SPBC1778.06c |fim1||fimbrin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 614

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +2

Query: 416 HDTPPDSVAKRVGTRQRGRVPAERFEYI-SGIFVLNSLPA 532
           +D+ PD++ +RV  +QR   P + F+ I +   V+NS  A
Sbjct: 160 NDSVPDTIDERVLNKQRNNKPLDNFKCIENNNVVINSAKA 199


>SPCC777.13 |vps35||retromer complex subunit
           Vps35|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 785

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 11/34 (32%), Positives = 21/34 (61%)
 Frame = +3

Query: 243 LVQQCVDFVQKIIRYYRCNDMSELSPLMIHFINT 344
           +V +C+ F+ +  R ++C D +E   L+  F+NT
Sbjct: 508 VVNRCI-FLARNFRIFKCMDWAEKVRLLWEFVNT 540


>SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 584

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 46  PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA 189
           PP+  P+  +    TN+   ++A G+ PP     K++  RS+S N  A
Sbjct: 536 PPIVKPNLMSEPTPTNSDEKSHALGFPPPP--GQKIEFQRSSSKNGTA 581


>SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 564

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +1

Query: 142 DNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGESIWYNNVW 261
           +NK+D       N++ I+P +K+ E  +D G    Y+  W
Sbjct: 67  ENKLDYIEDMGFNAIWISPIDKNIEGDID-GAGYAYHGYW 105


>SPAC1F8.03c |str3||siderophore-iron transporter Str3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 630

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +3

Query: 132 YDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           Y   QQN  E  Q HK   D+   QE++
Sbjct: 600 YLGNQQNAVEGDQDHKKKGDKETTQEEK 627


>SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 991

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 12/32 (37%), Positives = 14/32 (43%)
 Frame = +1

Query: 16   RGNFYYNTPPPPLRYPSNPATAIFTNAQTYNN 111
            RG  Y N PP    Y SN         ++YNN
Sbjct: 953  RGGGYSNGPPAGNHYSSNRGKGYGYQRESYNN 984


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,919,380
Number of Sequences: 5004
Number of extensions: 61243
Number of successful extensions: 265
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 245
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 263
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 345237368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -