SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC9.04 |Tf2-1||retrotransposable element|Schizosaccharomyces p...    63   3e-11
SPBC9B6.02c |Tf2-9|SPBC9B6.02|retrotransposable element|Schizosa...    63   3e-11
SPAC13D1.01c |Tf2-7||retrotransposable element|Schizosaccharomyc...    63   3e-11
SPAC27E2.08 |Tf2-6||retrotransposable element|Schizosaccharomyce...    63   3e-11
SPAC19D5.09c |Tf2-8|SPAC13D1.02c|retrotransposable element|Schiz...    63   3e-11
SPAC2E1P3.03c |Tf2-3||retrotransposable element|Schizosaccharomy...    63   3e-11
SPAC26A3.13c |Tf2-4||retrotransposable element|Schizosaccharomyc...    63   3e-11
SPCC1020.14 |Tf2-12||retrotransposable element|Schizosaccharomyc...    63   3e-11
SPBC1289.17 |Tf2-11|SPBC8E4.11c|retrotransposable element|Schizo...    63   3e-11
SPAPB15E9.03c |Tf2-5||retrotransposable element|Schizosaccharomy...    63   3e-11
SPAC167.08 |Tf2-2|SPAC1705.01c|retrotransposable element|Schizos...    63   3e-11
SPAC23A1.19c ||SPAC26H5.01c|RecQ type DNA helicase Hrq1 |Schizos...    28   1.4  
SPBC16C6.06 |pep1|vps10|sorting receptor for CPY|Schizosaccharom...    26   5.8  
SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pomb...    25   7.6  

>SPAC9.04 |Tf2-1||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPBC9B6.02c |Tf2-9|SPBC9B6.02|retrotransposable
           element|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC13D1.01c |Tf2-7||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC27E2.08 |Tf2-6||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC19D5.09c |Tf2-8|SPAC13D1.02c|retrotransposable
           element|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC2E1P3.03c |Tf2-3||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC26A3.13c |Tf2-4||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPCC1020.14 |Tf2-12||retrotransposable element|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPBC1289.17 |Tf2-11|SPBC8E4.11c|retrotransposable
           element|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAPB15E9.03c |Tf2-5||retrotransposable element|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC167.08 |Tf2-2|SPAC1705.01c|retrotransposable
           element|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1333

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601



 Score = 25.4 bits (53), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTP   +     K  L S  ++ H   + ++ L TDAS   VGA  ++
Sbjct: 678 WTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQ 725


>SPAC23A1.19c ||SPAC26H5.01c|RecQ type DNA helicase Hrq1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1063

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
 Frame = +1

Query: 388 PLPQTVQGLRRFIGMVN--YYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNAL 561
           P+P     L     ++N  Y   +LRN+  +  PL+N+ V   +K    ++G LS    +
Sbjct: 50  PIPSIFDNLFNLFKVINTTYTFLYLRNSLTITFPLLNSSVKQSLK-KELTIGDLSQLREI 108

Query: 562 MP 567
            P
Sbjct: 109 CP 110


>SPBC16C6.06 |pep1|vps10|sorting receptor for
           CPY|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1466

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -3

Query: 247 EKSTKVCSMLKSITGIH 197
           +K+T VCS+ KSIT +H
Sbjct: 599 KKATSVCSVPKSITDLH 615


>SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 323

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +1

Query: 301 APEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           A  V FL     A+   PP ER++ + +    Q VQ L+ +
Sbjct: 247 ASPVPFLNGNEPANSGLPPIERVEDIDELSKEQCVQYLKGY 287


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,622,926
Number of Sequences: 5004
Number of extensions: 51797
Number of successful extensions: 160
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 160
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 311890690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -