SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC409.03 |swi5||Swi5 protein|Schizosaccharomyces pombe|chr 2||...    28   1.1  
SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p...    27   2.0  
SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom...    27   3.4  
SPAC23H4.09 |cdb4||curved DNA-binding protein Cdb4|Schizosacchar...    26   4.5  
SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modifica...    25   7.9  

>SPBC409.03 |swi5||Swi5 protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 85

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = +3

Query: 99  YVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKY 218
           ++LEQ   Q++   +D  + LK  + K  V +H+D  + Y
Sbjct: 11  HLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTY 50


>SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 728

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 9/27 (33%), Positives = 19/27 (70%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLL 391
           L+ K GV+ L+ K KLP+++  ++ ++
Sbjct: 542 LLVKDGVVHLVDKVKLPFSVSQKDMII 568


>SPAC23C11.01 |||ER membrane protein, ICE2
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 441

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -2

Query: 439 CGVVLARA*HLRNYFF*KPFL*FYGVRKLAL 347
           CG++L  A  L  YFF    L  +G+RK+AL
Sbjct: 86  CGLILTLA--LEVYFFSTALLKLFGLRKIAL 114


>SPAC23H4.09 |cdb4||curved DNA-binding protein
           Cdb4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 381

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = +2

Query: 245 TALAPNSVAKQGDPLYLQPHTVLITKSG-VIQLIM 346
           TA++PN +A    PL   P   L  KSG V+++++
Sbjct: 81  TAVSPNDMAAHLSPLKSDPEANLALKSGDVVKILL 115


>SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl
           modification enzyme|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 666

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +2

Query: 392 EEVIPQVLCTGKYDPAIKQQEEKNKQL 472
           + V+ +++  GKY   IK+Q  +NKQL
Sbjct: 551 KRVLQRLIIEGKYTYYIKRQGTQNKQL 577


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,718,446
Number of Sequences: 5004
Number of extensions: 53258
Number of successful extensions: 180
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 180
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 325165428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -