SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces...    31   0.13 
SPAC57A7.09 |||human RNF family homolog|Schizosaccharomyces pomb...    30   0.38 
SPCC1223.04c |mug76||lysine methyltransferase |Schizosaccharomyc...    26   6.2  
SPBC582.07c |rpn7||19S proteasome regulatory subunit Rpn7|Schizo...    25   8.2  

>SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 513

 Score = 31.5 bits (68), Expect = 0.13
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR 203
           EC IC+E    N  ++ +P       +  FHE CI+ W R
Sbjct: 395 ECTICMEMFKINDDVIQLP------CKHYFHENCIKPWLR 428


>SPAC57A7.09 |||human RNF family homolog|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 372

 Score = 29.9 bits (64), Expect = 0.38
 Identities = 15/42 (35%), Positives = 19/42 (45%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           T   EC ICLE       +VA+P       +  FH  CI +W
Sbjct: 316 TFGVECVICLESFTKGDKVVALP------CKHEFHRPCIAKW 351


>SPCC1223.04c |mug76||lysine methyltransferase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 381

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -3

Query: 353 VDKRACKRNQFRDRL*TLWFL 291
           ++KR C R  FRD+L +  FL
Sbjct: 58  INKRTCSRYSFRDKLTSFQFL 78


>SPBC582.07c |rpn7||19S proteasome regulatory subunit
           Rpn7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 409

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = +2

Query: 185 HSALASRTHSRSF*SCYKILF*LSPKTLEECNAMLRETK-GFIGDHEIDCVYKRVYQRVT 361
           H  +  +  + S  +  + +F LS   LE  +    +T    I DH++  +YK + +   
Sbjct: 10  HRTMTEKARTVSDLTISQAIFELSSPFLENKSQKALDTLFSAIRDHDLAPLYKYLSENPK 69

Query: 362 QEDALDIELDFRNFFKKCNHDE 427
              ++D + +F N   K N ++
Sbjct: 70  TSASIDFDSNFLNSMIKKNEEK 91


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,833,839
Number of Sequences: 5004
Number of extensions: 57470
Number of successful extensions: 140
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 139
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 337208592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -