SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar...   142   6e-35
SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc...   100   4e-22
SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su...    93   3e-20
SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha...    83   3e-17
SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosacch...    73   5e-14
SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomy...    68   1e-12
SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccha...    62   5e-11
SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomy...    58   9e-10
SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomy...    56   6e-09
SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac...    55   1e-08
SPAC1006.07 |||translation initiation factor eIF4A|Schizosacchar...    54   2e-08
SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomy...    54   3e-08
SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccha...    54   3e-08
SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A related|Schizosa...    52   1e-07
SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1 |Schizosacch...    49   7e-07
SPBC691.04 |||mitochondrial ATP-dependent RNA helicase Mss116 |S...    47   3e-06
SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomy...    47   3e-06
SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomy...    44   2e-05
SPCC1494.06c |||ATP-dependent RNA helicase Dbp9 |Schizosaccharom...    44   3e-05
SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyc...    42   6e-05
SPAC17G6.14c |uap56||ATP-dependent RNA helicase Uap56|Schizosacc...    40   4e-04
SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyce...    39   6e-04
SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1 |Schizosacch...    39   8e-04
SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom...    30   0.36 
SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom...    30   0.36 
SPAC27F1.06c |||FKBP-type peptidyl-prolyl cis-trans isomerase |S...    27   2.5  
SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual            26   5.8  
SPBC28E12.05 |esf2|SPBC3H7.17c|U3 snoRNP-associated protein Esf2...    26   5.8  

>SPBP8B7.16c |dbp2||ATP-dependent RNA helicase
           Dbp2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 550

 Score =  142 bits (343), Expect = 6e-35
 Identities = 63/84 (75%), Positives = 75/84 (89%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+   TNL+R TYLVLDEADRMLDMGFEPQIRKI++QIRPDRQT+M+SATWPKE
Sbjct: 254 GRLLDMLDSNKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTVMFSATWPKE 313

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LA DYL DYIQ+ +GSL L+A
Sbjct: 314 VQRLARDYLNDYIQVTVGSLDLAA 337



 Score =  121 bits (292), Expect = 8e-29
 Identities = 59/84 (70%), Positives = 65/84 (77%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y LPAIVHIN QP +  GDGPI LVLAPTRELA QIQQ    FG +S +RNTC
Sbjct: 169 GSGKTLSYCLPAIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQQECTKFGKSSRIRNTC 228

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG P+  Q RDL RGVEI IAT
Sbjct: 229 VYGGVPRGPQIRDLIRGVEICIAT 252



 Score = 29.9 bits (64), Expect = 0.36
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           +HNI QIV++    +K  +L   ++E+ + ++   K +IF  TKR
Sbjct: 338 SHNIKQIVEVVDNADKRARLGKDIEEVLKDRD--NKVLIFTGTKR 380


>SPCC10H11.01 |prp11||ATP-dependent RNA helicase
           Prp11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1014

 Score = 99.5 bits (237), Expect = 4e-22
 Identities = 49/99 (49%), Positives = 65/99 (65%), Gaps = 3/99 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L       TNL RCTYLVLDEADRM D+GFEPQ+ +II  IR
Sbjct: 538 LKRGAEIVVCTPGRMIDVLSANAGRVTNLHRCTYLVLDEADRMFDLGFEPQVMRIINNIR 597

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           PDRQT+++SAT+P+ ++ LA   L   ++I +G   + A
Sbjct: 598 PDRQTVLFSATFPRAMEALARKVLKKPVEITVGGRSVVA 636



 Score = 92.7 bits (220), Expect = 4e-20
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q P++ G+GPIA+++ PTRELA QI +    F     +R  C
Sbjct: 465 GSGKTIAFLLPMFRHIKDQRPLKTGEGPIAIIMTPTRELAVQIFRECKPFLKLLNIRACC 524

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GGAP ++Q  DL+RG EIV+ T
Sbjct: 525 AYGGAPIKDQIADLKRGAEIVVCT 548


>SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase
           Sum3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 636

 Score = 93.1 bits (221), Expect = 3e-20
 Identities = 43/82 (52%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL+D +++G  +L    +LVLDEADRMLDMGFEPQIR I+E        +RQTLM+SAT
Sbjct: 314 GRLVDLIDRGRISLANIKFLVLDEADRMLDMGFEPQIRHIVEGADMTSVEERQTLMFSAT 373

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P++++ LA D+L DY+ +++G
Sbjct: 374 FPRDIQLLARDFLKDYVFLSVG 395



 Score = 54.0 bits (124), Expect = 2e-08
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQP---PIRRGDG---------PIALVLAPTRELAQQIQQVA 143
           GSGKT  ++ P + +  +  P   P+ +  G         P  L+LAPTREL  QI + +
Sbjct: 216 GSGKTAGFLFPILSLAFDKGPAAVPVDQDAGMGYRPRKAYPTTLILAPTRELVCQIHEES 275

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S+VR   V+GGA  R Q R +++G +++ AT
Sbjct: 276 RKFCYRSWVRPCAVYGGADIRAQIRQIDQGCDLLSAT 312



 Score = 25.4 bits (53), Expect = 7.7
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 547 HEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKLRT 654
           H ++++    L +I  +  P   T+IFVETKR   T
Sbjct: 410 HVEDSEKRSYLLDILHTLPPEGLTLIFVETKRMADT 445


>SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 578

 Score = 83.4 bits (197), Expect = 3e-17
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 6/90 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------RQTLMWS 418
           GRL+D +  G+ +  +  YLVLDEADRMLD GFE  IR II    PD      RQT+ +S
Sbjct: 294 GRLLDLINDGSIDCSQVGYLVLDEADRMLDTGFEQDIRNIISH-TPDPTRNGSRQTVFFS 352

Query: 419 ATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           ATWP+ V+ LA  +L D ++I IGS +L+A
Sbjct: 353 ATWPESVRALAATFLKDPVKITIGSDELAA 382



 Score = 53.2 bits (122), Expect = 3e-08
 Identities = 31/84 (36%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A+ +PA+ ++N     +    P  LV++PTRELA Q  +        + ++   
Sbjct: 212 GSGKTVAFGIPALQYLNGLSDNK--SVPRVLVVSPTRELAIQTYENLNSLIQGTNLKAVV 269

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGAPK EQAR   +   ++I T
Sbjct: 270 VYGGAPKSEQAR-AAKNASVIIGT 292



 Score = 28.7 bits (61), Expect = 0.82
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +1

Query: 508 NHNILQIVDICQE-HEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKLRTYQGT 666
           + NI QIV+I  +   KE  L+ LL++   S     K +IFV  K++    +GT
Sbjct: 383 SQNITQIVEILDDPRSKERMLDNLLRKHLSSGGKDDKILIFVLYKKEAARVEGT 436


>SPCC63.11 |prp28||U5 snRNP-associated protein Prp28
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score = 72.5 bits (170), Expect = 5e-14
 Identities = 40/87 (45%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD---GPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A+I+P I+ I+  PP+   +   GP A+VLAPTRELAQQIQ     F      R
Sbjct: 296 GSGKTAAFIIPLIIAISKLPPLTESNMHLGPYAVVLAPTRELAQQIQVEGNKFAEPLGFR 355

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V GG    EQ+  + +G  IV+AT
Sbjct: 356 CVSVVGGHAFEEQSFQMSQGAHIVVAT 382



 Score = 68.9 bits (161), Expect = 6e-13
 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 19/99 (19%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------------- 397
           GRL+D LE+    L +CTY+V+DEADRMLDMGFE  + KI+  +                
Sbjct: 384 GRLLDCLERRLFVLSQCTYVVMDEADRMLDMGFEDDVNKILSSLPSSNASEKDGSILATA 443

Query: 398 ------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                 RQT+M+SAT P  V  LA+ YL + + + IG++
Sbjct: 444 NSSSSRRQTIMFSATLPPRVANLAKSYLIEPVMLTIGNI 482


>SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 465

 Score = 67.7 bits (158), Expect = 1e-12
 Identities = 40/99 (40%), Positives = 62/99 (62%), Gaps = 2/99 (2%)
 Frame = +2

Query: 248 CYSGRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSA 421
           C  GRL+D LE  KG + L+   YL++DEADR+LDM F P I KI++ I  +R+TL++SA
Sbjct: 170 CTPGRLMDHLENTKGFS-LKNLKYLIMDEADRLLDMDFGPIIDKILKIIPHERRTLLFSA 228

Query: 422 TWPKEVKKLAEDYLGDYIQINIGSLQLSAITTFFKL*IF 538
           T   +V+KL    L   +++ + S + S + T  +  +F
Sbjct: 229 TMTSKVEKLQRASLHQPVRVAVSS-KFSTVDTLIQRYLF 266



 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKT A+ LP I  + NN  P        A+VLAPTRELA QI +     G +  VR+ 
Sbjct: 93  GSGKTAAFALPVIQELWNNPSPF------FAVVLAPTRELAYQISEQFEAIGGSIGVRSV 146

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG     QA  L +   +++ T
Sbjct: 147 VIVGGMDMVTQAVALSKKPHVLVCT 171


>SPBC776.09 |ste13||ATP-dependent RNA helicase
           Ste13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 485

 Score = 62.5 bits (145), Expect = 5e-11
 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D   KG  +   CT  V+DEAD++L   F P I +++     +RQ  ++SAT+P  
Sbjct: 171 GRVLDLAGKGVADFSECTTFVMDEADKLLSPEFTPIIEQLLSYFPKNRQISLYSATFPLI 230

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   + +L    +IN+   L L  +T ++
Sbjct: 231 VKNFMDKHLNKPYEINLMDELTLRGVTQYY 260



 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+++P++  ++ +    +      L+L PTRELA Q  QV    G    V+   
Sbjct: 91  GTGKTAAFVIPSLEKVDTKKSKIQ-----TLILVPTRELALQTSQVCKTLGKHMNVKVMV 145

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   R+    L   V IV+ T
Sbjct: 146 TTGGTTLRDDIIRLNDTVHIVVGT 169


>SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 709

 Score = 58.4 bits (135), Expect = 9e-10
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI--RRGDGPIALVLAPTRELAQQIQQVAADFGH---TSY 167
           GSGKTLAY+LP +  +   P     R  G  A+++APTREL QQI  VA    +   + +
Sbjct: 188 GSGKTLAYLLPIVQRLIRLPKNLHTRTSGIYAVIMAPTRELCQQIYNVANKLNNNPLSHW 247

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + +  V GG  K+ +   + +GV I+I T
Sbjct: 248 IVSCNVIGGEKKKSEKARIRKGVNILIGT 276



 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 14/89 (15%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR------------PD 397
           GRL D LE     ++ +  ++VLDE DR++DMGFE  + KI+  +             P 
Sbjct: 278 GRLADHLENTEALDVSQVRWVVLDEGDRLMDMGFEETLTKILSYLESQSSIIKKDLSIPS 337

Query: 398 RQ-TLMWSATWPKEVKKLAEDYLGDYIQI 481
           R+ T++ SAT    VK+L++  L D + +
Sbjct: 338 RKVTMLCSATMKDTVKRLSDSALKDALYL 366


>SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 735

 Score = 55.6 bits (128), Expect = 6e-09
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  +++    +      L+LDEADR+LDMGF   +  I+  +   RQT+++SAT
Sbjct: 166 CTPGRLLQHIDQAVNFDTSGLQMLILDEADRILDMGFRTTLDAIVSSLPVHRQTMLFSAT 225

Query: 425 WPKEVKKLA 451
             K VK LA
Sbjct: 226 QTKSVKDLA 234



 Score = 45.2 bits (102), Expect = 9e-06
 Identities = 30/84 (35%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+I+P I ++  +      DG  ALV++PTRELA Q  +     G         
Sbjct: 86  GSGKTLAFIVPLIENLYRKKWTSL-DGLGALVISPTRELAIQTFETLVKIGRLHSFSAGL 144

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   +E+   L R + I++ T
Sbjct: 145 IIGGNNYKEEKERLSR-MNILVCT 167


>SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 848

 Score = 54.8 bits (126), Expect = 1e-08
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++P I H+ +           AL+L+P RELA Q  +V  DF   + +R+  
Sbjct: 116 GSGKTAAFVIPMIEHLKST---LANSNTRALILSPNRELALQTVKVVKDFSKGTDLRSVA 172

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    EQ   L    +IV+AT
Sbjct: 173 IVGGVSLEEQFSLLSGKPDIVVAT 196



 Score = 53.6 bits (123), Expect = 3e-08
 Identities = 26/77 (33%), Positives = 43/77 (55%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR +    +    L    Y+V DEADR+ +MGF  Q+ +I+  +   RQTL++SAT P+ 
Sbjct: 198 GRFLHLKVEMKLELSSIEYVVFDEADRLFEMGFAAQLTEILHALPTSRQTLLFSATLPRT 257

Query: 437 VKKLAEDYLGDYIQINI 487
           +   A+  L D + + +
Sbjct: 258 LVDFAKAGLQDPVLVRL 274


>SPAC1006.07 |||translation initiation factor
           eIF4A|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 392

 Score = 54.0 bits (124), Expect = 2e-08
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +++           VLDEAD ML  GF+ QI  I + + P  Q ++ SAT P++
Sbjct: 146 GRVHDMIQRRALPTDAVQMFVLDEADEMLSRGFKDQIYDIFQLLPPTAQVVLLSATMPQD 205

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           V ++   ++ D I+I +    L L  I  F+
Sbjct: 206 VLEVTTKFMRDPIRILVKKDELTLEGIKQFY 236



 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+    +++     AL+LAPTRELAQQIQ+V    G    V    
Sbjct: 66  GTGKTATFSISVLQKIDTS--LKQCQ---ALILAPTRELAQQIQKVVVALGDLMNVECHA 120

Query: 183 VFGGAPKREQARDLERGVEIVIAT--QVD*LISWKRAQPT 296
             GG   R+    L+ GV +V+ T  +V  +I  +RA PT
Sbjct: 121 CIGGTLVRDDMAALQAGVHVVVGTPGRVHDMIQ-RRALPT 159


>SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 578

 Score = 53.6 bits (123), Expect = 3e-08
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAI--VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKTLA+++P I  ++     P R G G I  +++PTRELA QI  VA +     +   
Sbjct: 136 GSGKTLAFLIPTIEMLYALKFKP-RNGTGVI--IISPTRELALQIFGVAKELLKYHHQTF 192

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V GGA +R +A  L +GV +++AT
Sbjct: 193 GIVIGGANRRAEADKLVKGVNLLVAT 218



 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 3/68 (4%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPDRQTLMWSATW 427
           GRL+D L+  KG    +    LV+DEADR+L++GFE ++R+I++ +   +RQTL++SAT 
Sbjct: 220 GRLLDHLQNTKGFV-FRNLRSLVIDEADRILEIGFEDEMRQIMKILPSENRQTLLFSATQ 278

Query: 428 PKEVKKLA 451
             +V+ LA
Sbjct: 279 TTKVEDLA 286


>SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 453

 Score = 53.6 bits (123), Expect = 3e-08
 Identities = 32/84 (38%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I   +  P      G  AL+L PTRELA QI +  A  G    +++  
Sbjct: 54  GSGKTAAFALPIIEKWSKDP-----SGIFALILTPTRELAIQIDEQFAALGANLNLKHAL 108

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q+ DL +   +V+AT
Sbjct: 109 IVGGMDMIRQSIDLSKRPHVVVAT 132



 Score = 38.7 bits (86), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 6/70 (8%)
 Frame = +2

Query: 257 GRLIDFL----EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWS 418
           GRL D +    E+    L+R  +LV+DEADR+L   F   +      +    DRQTL+++
Sbjct: 134 GRLADLIRSNGEETIAGLRRIKFLVMDEADRLLSPTFADDLDDCFSVLPASEDRQTLLFT 193

Query: 419 ATWPKEVKKL 448
           AT    +++L
Sbjct: 194 ATVTDAIRQL 203


>SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A
           related|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 394

 Score = 51.6 bits (118), Expect = 1e-07
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 2/124 (1%)
 Frame = +2

Query: 158 HILCS*HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADR 337
           H+    H C+   S       L  G        GR+ D + +     +    L+LDEAD 
Sbjct: 115 HMNVQCHACIGGTSVGNDIKKLDYGQHVVSGTPGRVTDMIRRRNLRTRNVKMLILDEADE 174

Query: 338 MLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAI 511
           +L+ GF+ QI  I   + P  Q ++ SAT P++V ++   +  + ++I +    L L  +
Sbjct: 175 LLNQGFKEQIYDIYRYLPPGTQVVVVSATLPQDVLEMTNKFTTNPVRILVKRDELTLEGL 234

Query: 512 TTFF 523
             +F
Sbjct: 235 KQYF 238



 Score = 37.5 bits (83), Expect = 0.002
 Identities = 21/55 (38%), Positives = 27/55 (49%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           AL+L+PTRELA QIQ V    G    V+     GG       + L+ G  +V  T
Sbjct: 92  ALILSPTRELAVQIQNVVLALGDHMNVQCHACIGGTSVGNDIKKLDYGQHVVSGT 146


>SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 754

 Score = 48.8 bits (111), Expect = 7e-07
 Identities = 29/84 (34%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I+P +  +  +P  ++      L+L PTRELA Q   VA      + +    
Sbjct: 306 GSGKTAAFIVPILERLLYRP--KKVPTTRVLILCPTRELAMQCHSVATKIASFTDIMVCL 363

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   + Q ++L +  +IVIAT
Sbjct: 364 CIGGLSLKLQEQELRKRPDIVIAT 387



 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR ID +       ++    +V+DEADRML+ GF  ++ +II+     RQT+++SAT   
Sbjct: 389 GRFIDHMRNSQGFTVENIEIMVMDEADRMLEDGFADELNEIIQACPKSRQTMLFSATMTD 448

Query: 434 EVKKLAEDYLGDYIQINIGSLQLSA 508
           +V  L    L   +++ + + + +A
Sbjct: 449 KVDDLIRLSLNRPVRVFVDNKKTTA 473


>SPBC691.04 |||mitochondrial ATP-dependent RNA helicase Mss116
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 535

 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA++L A   +    P        +++L+PTRELA QI + A    + + +R + 
Sbjct: 86  GTGKTLAFLLVAFKDVLKGKPRLNSSKIHSVILSPTRELALQIFEEARKLTYGTGIRVSY 145

Query: 183 VFGGAPKREQARDLERG-VEIVIAT 254
             GG  K  +   + RG   ++IAT
Sbjct: 146 AIGGNSKMREENAIRRGNANLLIAT 170



 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 30/79 (37%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCT-YLVLDEADRMLDMGFEPQIRKIIEQIRPDR-QTLMWSATWP 430
           GRL D L+         T   +LDEADR++DMGF   I  I E +   + + L +SAT P
Sbjct: 172 GRLEDHLQNPRILESLSTDSFILDEADRLMDMGFAESILNIHEAVTTTKTRKLCFSATMP 231

Query: 431 KEVKKLAEDYLG-DYIQIN 484
            +V  +    LG D+  IN
Sbjct: 232 PKVSNVFRGILGTDFKLIN 250


>SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 648

 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI--ALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKTLA+ +P + H      +R  D     ALV+APTRELA QI Q       +  +R 
Sbjct: 169 GSGKTLAFGIPILEHC-----LRNVDAKYVQALVVAPTRELAHQICQHFELIKPSPNIRV 223

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG   ++Q R L +   +V+AT
Sbjct: 224 MSITGGLAVQKQQRLLNKHPHVVVAT 249



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 6/69 (8%)
 Frame = +2

Query: 257 GRLIDFLEKG--TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWS 418
           GRL   + +   T N ++   LVLDEADR+L      ++ K++E     +   RQT ++S
Sbjct: 251 GRLWSVINENNLTGNFKKIKCLVLDEADRLLQKSHFEELSKLLEILGNPMHTQRQTFIFS 310

Query: 419 ATWPKEVKK 445
           AT+ + +++
Sbjct: 311 ATFDEGLQQ 319


>SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 606

 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 24/49 (48%), Positives = 30/49 (61%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD 149
           GSGKTLAY+LP    +  +     G G  AL++APTRELA QI  V  +
Sbjct: 48  GSGKTLAYLLPCFDKVTRRDTDETGLG--ALIVAPTRELATQIFNVTKE 94



 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 18/37 (48%), Positives = 28/37 (75%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           L+LDEAD ++DMGF+  ++ II Q+   R+T ++SAT
Sbjct: 158 LILDEADTLIDMGFQRTLQSIISQLPKQRRTGLFSAT 194


>SPCC1494.06c |||ATP-dependent RNA helicase Dbp9
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 595

 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQV 140
           GSGKT AY++P +  +  Q  I     G  AL+L PTRELAQQ+  V
Sbjct: 61  GSGKTAAYLIPILELLLKQKQIDENQRGIFALLLVPTRELAQQVYNV 107



 Score = 38.3 bits (85), Expect = 0.001
 Identities = 18/63 (28%), Positives = 31/63 (49%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEV 439
           R +  +  G   L +  +LV+DEAD ML  G+   ++ +   +    Q+ + SAT  K +
Sbjct: 150 RCVVHVASGVLPLDKLKFLVIDEADLMLSFGYNEDMKTLSRSLPRGTQSFLMSATLSKNI 209

Query: 440 KKL 448
             L
Sbjct: 210 ASL 212


>SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 503

 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           G ++D +++   + +     VLDEAD MLD  G   Q  +I   +  + Q +++SAT+ +
Sbjct: 239 GTVMDLMKRRQLDARDIKVFVLDEADNMLDQQGLGDQSMRIKHLLPRNTQIVLFSATFSE 298

Query: 434 EVKKLAEDYLGDYIQINIGSLQLS 505
            V+K AE +  +  +I + + +LS
Sbjct: 299 RVEKYAERFAPNANEIRLKTEELS 322



 Score = 37.5 bits (83), Expect = 0.002
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKT A+ L  +  ++   P      P A+ LAP+RELA+QI  V  + G  + V+
Sbjct: 163 GTGKTAAFALTMLSRVDASVP-----KPQAICLAPSRELARQIMDVVTEMGKYTEVK 214


>SPAC17G6.14c |uap56||ATP-dependent RNA helicase
           Uap56|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 39.5 bits (88), Expect = 4e-04
 Identities = 18/78 (23%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL   + +    +    + VLDE D++L+ +     I+++     P +Q +M+SAT   
Sbjct: 182 GRLNALVREKILKVNSVKHFVLDECDKLLESVDMRRDIQEVFRATPPQKQVMMFSATLSN 241

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ + ++I +
Sbjct: 242 EIRPICKKFMQNPLEIYV 259



 Score = 35.5 bits (78), Expect = 0.007
 Identities = 31/89 (34%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIA-LVLAPTRELAQQIQQVAADFG-HTSYVRN 176
           G GKT  ++L  +  I    P+   DG ++ LVL  TRELA QI+   A F  +   VR 
Sbjct: 98  GMGKTAVFVLSTLQQIE---PV---DGEVSVLVLCHTRELAFQIKNEYARFSKYLPDVRT 151

Query: 177 TCVFGG---APKREQARDLERGVEIVIAT 254
              +GG       E  +D  +   IV+AT
Sbjct: 152 AVFYGGINIKQDMEAFKDKSKSPHIVVAT 180


>SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 604

 Score = 39.1 bits (87), Expect = 6e-04
 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           GRL+D +    + +LQ   Y+V+DEADR+LD  F+  +  ++ +I
Sbjct: 269 GRLVDHIRNDESFSLQHLRYMVIDEADRLLDQSFQDWVDTVMMEI 313



 Score = 31.9 bits (69), Expect = 0.088
 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ--PPIRRGDGPIALVLAPTRELAQQI 131
           GSGKTL+Y++P +  ++++  P +R       +V+ PTREL  Q+
Sbjct: 183 GSGKTLSYVIPIVQCLSHRTVPRLR------CVVIVPTRELTVQV 221


>SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 481

 Score = 38.7 bits (86), Expect = 8e-04
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR-QTLMWSATWPKE 436
           RL+  ++ G +  ++  + V+DEADR+ + GF  Q   I+           ++SAT P  
Sbjct: 176 RLVQAIQTGLS-FEKVEFFVMDEADRLFEPGFIEQTDHILSACTSSNICKSLFSATIPSR 234

Query: 437 VKKLAEDYLGDYIQINIG 490
           V++LA+    D I+I +G
Sbjct: 235 VEELAKVVTVDPIRIIVG 252



 Score = 38.3 bits (85), Expect = 0.001
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT+AY+ P +  +    P     G  A+++APTREL +QI + A
Sbjct: 93  GSGKTIAYLFPILQKLQLHVP----GGYRAIIVAPTRELCEQIYRQA 135


>SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces
            pombe|chr 1||Partial|Manual
          Length = 1887

 Score = 29.9 bits (64), Expect = 0.36
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 131
            G GK+L++++PA++    Q P  +    + LVL P   L Q +
Sbjct: 1216 GGGKSLSFLIPALIEKKRQTP-GKVMNMVTLVLVPMMSLRQDM 1257


>SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1919

 Score = 29.9 bits (64), Expect = 0.36
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 131
            G GK+L++++PA++    Q P  +    + LVL P   L Q +
Sbjct: 1216 GGGKSLSFLIPALIEKKRQTP-GKVMNMVTLVLVPMMSLRQDM 1257


>SPAC27F1.06c |||FKBP-type peptidyl-prolyl cis-trans isomerase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 362

 Score = 27.1 bits (57), Expect = 2.5
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +3

Query: 84  PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLE 227
           PI ++ +P  E+    ++V  D     Y+  TC+    P+ E + DLE
Sbjct: 93  PIDIIFSPGEEVF--FERVGGDI--PVYLSGTCIITNIPEEEDSSDLE 136


>SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 421

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 7/58 (12%)
 Frame = +2

Query: 2   GFRQNVGLHLASHC-------AHKQPTAYSER*WSDCFGLGAYQRVSTTNSASCCRFW 154
           GF  + G  +  HC        H++  AY E      F    Y R++T +   C R W
Sbjct: 33  GFSCSTGEKIFEHCYRDNINEKHREAAAYGEAIRQVAFSKD-YSRMATVSEDKCLRLW 89


>SPBC28E12.05 |esf2|SPBC3H7.17c|U3 snoRNP-associated protein Esf2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 334

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 377 IEQIRPDRQTLMWSATWPKEVKKLAED 457
           I + R +R TL  S  +P+E K L+ED
Sbjct: 268 IRKKRSERDTLNVSTEFPEETKDLSED 294


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,909,628
Number of Sequences: 5004
Number of extensions: 60642
Number of successful extensions: 244
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 193
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 227
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 313902888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -