SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|c...    31   0.11 
SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch...    29   0.78 
SPBC582.06c |mcp6|hrs1, mug3|meiosis specific coiled-coil protei...    28   1.4  
SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|c...    27   1.8  
SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizos...    27   2.4  
SPAC222.13c |||6-phosphofructo-2-kinase |Schizosaccharomyces pom...    26   5.5  
SPBC11C11.03 |ndc80|ndc10, tid3|spindle pole body protein Ndc80|...    25   7.3  
SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharom...    25   7.3  
SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    25   7.3  
SPBC1A4.02c |leu1|SPBC1E8.07c|3-isopropylmalate dehydrogenase Le...    25   9.7  
SPAC14C4.14 |atp1||F1-ATPase alpha subunit|Schizosaccharomyces p...    25   9.7  
SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce...    25   9.7  

>SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 649

 Score = 31.5 bits (68), Expect = 0.11
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = +3

Query: 531 GQSQLRCQYSARTREV*FWNPVTF--FIYLFR*TVCFLSLYTLV 656
           GQ  L C +S       FWNP  +  F Y F  ++ ++ L+TLV
Sbjct: 277 GQDVLDCLFSNHILSFNFWNPAGWMTFFYYFAISLAYMVLHTLV 320


>SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase
           Y|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1002

 Score = 28.7 bits (61), Expect = 0.78
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +2

Query: 113 ERERPVHHRGGRDRQPGRHHGGDEDR 190
           E E P HHRG  D++   HH G +D+
Sbjct: 349 EHEGPEHHRGPEDKE---HHKGPKDK 371



 Score = 25.4 bits (53), Expect = 7.3
 Identities = 14/41 (34%), Positives = 18/41 (43%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHH 172
           DD    +D R + H+   D  +RE P HH  G    P   H
Sbjct: 175 DDSVFFDDERPKHHE--FDDEDREFPAHHEPGEHMPPPPMH 213


>SPBC582.06c |mcp6|hrs1, mug3|meiosis specific coiled-coil protein
           Mcp6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 327

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = +2

Query: 218 KFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRL 337
           KFE  +   KS +S  T L + M   +  +ET+ K++ ++
Sbjct: 148 KFEESSLRCKSLYSSNTKLKDSMETMKRRMETETKEMNKI 187


>SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 594

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +2

Query: 311 TQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLEPAKV 457
           T+M +L+  I+T S+ S   ++ I   L++++ DL E  +  +  P+ V
Sbjct: 77  TEMIELRNHIITLSKRSVNMESRIDDMLNLLNYDLSEKRETSNEIPSLV 125


>SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein
           Rad50|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1290

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 11/52 (21%), Positives = 25/52 (48%)
 Frame = +2

Query: 206 TTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSS 361
           T + + + +  +    + +Q   I H+ +Q  ++ T + DLK  +    +SS
Sbjct: 247 TETARLQDELFKSTEEYEQQMITIRHLESQSDIINTTINDLKSQMTITDESS 298


>SPAC222.13c |||6-phosphofructo-2-kinase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 592

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +2

Query: 134 HRGGRDRQPGRHHGGDEDRVRLPGTTSPK 220
           HR  R R+PGR     E  + +PG T  K
Sbjct: 99  HRKNRLRRPGRFPVRQESTIDIPGLTVSK 127


>SPBC11C11.03 |ndc80|ndc10, tid3|spindle pole body protein
           Ndc80|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 624

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 19/93 (20%), Positives = 42/93 (45%)
 Frame = +2

Query: 182 EDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSS 361
           E+R R       KF+      KS    +T+L++ +       E+Q++ LK    +     
Sbjct: 302 EERYRTMQRDEVKFQSAMSGMKSKMESRTNLMKQLQVNIEEKESQLQLLKEKRDSLKYQV 361

Query: 362 AKSDAEIAKALSVVHQDLDEADKDRDLEPAKVS 460
              D  I++   +V  + ++ D++ ++  +K+S
Sbjct: 362 ENQDISISEFEKMV-SEREQLDRNLNMIGSKIS 393


>SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1150

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
 Frame = +2

Query: 275  IEHMHNQEHLVETQMKDLK-RLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLEPA 451
            ++  +  +H   T+ K    R + T   S   S +E+A   S+     DEA  + D +P 
Sbjct: 1078 LDERNTPKHTASTKRKRQPIRRVTTNLTSDVPSGSEVADTNSLSSTTKDEASPNSDAQP- 1136

Query: 452  KVSLEP 469
            K  ++P
Sbjct: 1137 KPQVKP 1142


>SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 390

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 12/39 (30%), Positives = 24/39 (61%)
 Frame = +2

Query: 248 SSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSA 364
           +S +++ SL   +H+++ L+E  + + K+ I  ASQ  A
Sbjct: 76  ASLNEKKSLSCDLHSRKQLIEDDLSNRKKSINIASQKLA 114


>SPBC1A4.02c |leu1|SPBC1E8.07c|3-isopropylmalate dehydrogenase
           Leu1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 371

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +3

Query: 126 LYTIAGGGTASRADITEAMKTE 191
           LYT   GG AS ADIT+A+  E
Sbjct: 345 LYTRDLGGEASTADITKAVVEE 366


>SPAC14C4.14 |atp1||F1-ATPase alpha subunit|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 536

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = -3

Query: 485 LLGFDLVPATPWPVPGRGPCQPRRDLGARLRGPSLFPR 372
           LLG  +V A   P+ G+GP +       +L+ P + PR
Sbjct: 131 LLG-RVVDALGNPIDGKGPIKTTERRRVQLKAPGILPR 167


>SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1347

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 12/66 (18%), Positives = 36/66 (54%)
 Frame = +3

Query: 57   NNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFAYQEQLAQNLKLMQ 236
            NN+   A  R+++EQ+ A +++   T+       +A   ++ + +   +++L++ + + +
Sbjct: 1089 NNNTTRASLRELLEQEKADASTT--TVLSDSRFMKAPTKKSQREK---KKELSKQVPISK 1143

Query: 237  ENINHL 254
             N+ H+
Sbjct: 1144 TNVGHI 1149


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,581,801
Number of Sequences: 5004
Number of extensions: 51961
Number of successful extensions: 193
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 186
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 193
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 299817502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -