SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC26A3.07c |rpl1101|rpl11-1, rpl11|60S ribosomal protein L11|S...   142   5e-35
SPBC17G9.10 |rpl1102|rpl11-2|60S ribosomal protein L11|Schizosac...   142   5e-35
SPAC1D4.05c |||Erd1 homolog|Schizosaccharomyces pombe|chr 1|||Ma...    28   0.94 
SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pom...    28   0.94 
SPBC1734.15 |rsc4|brd1|RSC complex subunit Rsc4|Schizosaccharomy...    26   5.0  
SPAC24C9.06c |||aconitate hydratase|Schizosaccharomyces pombe|ch...    25   6.6  
SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ...    25   6.6  
SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subu...    25   8.8  

>SPAC26A3.07c |rpl1101|rpl11-1, rpl11|60S ribosomal protein
           L11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 174

 Score =  142 bits (343), Expect = 5e-35
 Identities = 64/94 (68%), Positives = 76/94 (80%)
 Frame = +1

Query: 226 KDCCPLYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIY 405
           K  C +     KAEEILERGLKV+EYEL++ NFSATGNFGFGIQEHIDLGIKYDPSIGIY
Sbjct: 64  KIACHVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGIY 123

Query: 406 GLDFYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           G+DFYVV+ RPG  VA R+ + G+VG+ H++  E
Sbjct: 124 GMDFYVVMDRPGMRVARRKAQRGRVGYTHKINAE 157



 Score =  110 bits (264), Expect = 2e-25
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query: 44  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           + ++N M+ L I KL LNI +GESGDRLTRAAKVLEQL+GQ PVFSKARYT+R FGIRRN
Sbjct: 3   EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN 62

Query: 224 EKIAVHCTVRELKQKKSL-RGV 286
           EKIA H TVR  K ++ L RG+
Sbjct: 63  EKIACHVTVRGPKAEEILERGL 84


>SPBC17G9.10 |rpl1102|rpl11-2|60S ribosomal protein
           L11|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 174

 Score =  142 bits (343), Expect = 5e-35
 Identities = 64/94 (68%), Positives = 76/94 (80%)
 Frame = +1

Query: 226 KDCCPLYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIY 405
           K  C +     KAEEILERGLKV+EYEL++ NFSATGNFGFGIQEHIDLGIKYDPSIGIY
Sbjct: 64  KIACHVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGIY 123

Query: 406 GLDFYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           G+DFYVV+ RPG  VA R+ + G+VG+ H++  E
Sbjct: 124 GMDFYVVMDRPGMRVARRKAQRGRVGYTHKINAE 157



 Score =  110 bits (264), Expect = 2e-25
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query: 44  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           + ++N M+ L I KL LNI +GESGDRLTRAAKVLEQL+GQ PVFSKARYT+R FGIRRN
Sbjct: 3   EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN 62

Query: 224 EKIAVHCTVRELKQKKSL-RGV 286
           EKIA H TVR  K ++ L RG+
Sbjct: 63  EKIACHVTVRGPKAEEILERGL 84


>SPAC1D4.05c |||Erd1 homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 387

 Score = 28.3 bits (60), Expect = 0.94
 Identities = 17/56 (30%), Positives = 24/56 (42%)
 Frame = -1

Query: 290 FKPLSRISSALALGLYNGQQSFHYDGYQKTALYT*PWKIQAVVL*VAPTPWRHESA 123
           F  +  IS A    L+  +      G     +Y   W I A +L V P PWR+ S+
Sbjct: 96  FAAILSISWATGFILFLKKTQGDIGGLYSHPIYPLLWVITAFILIVFPFPWRYRSS 151


>SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1125

 Score = 28.3 bits (60), Expect = 0.94
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -3

Query: 282 PLKDFFCFSSRTVQWTAIFSLRRIPKDR 199
           PL D + F   T+ WT + S+ R P  R
Sbjct: 271 PLSDLWLFDLETLSWTEVRSIGRFPGPR 298


>SPBC1734.15 |rsc4|brd1|RSC complex subunit Rsc4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 542

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 13/44 (29%), Positives = 24/44 (54%)
 Frame = -3

Query: 285 TPLKDFFCFSSRTVQWTAIFSLRRIPKDRTVYLALENTGCCPVS 154
           TP+ DF  FS ++V   + F++   P+ +  +  + NT  C +S
Sbjct: 353 TPVPDFLNFSHKSVMGRSTFNMPNFPEPK-FFEDIPNTERCILS 395


>SPAC24C9.06c |||aconitate hydratase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 778

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 13/48 (27%), Positives = 20/48 (41%)
 Frame = +2

Query: 74  HIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           H++ +  N  +G        A K+ +QLTG+           R  GIR
Sbjct: 604 HLQNISNNYMIGAINAENGEANKLKDQLTGEYKTVPNVAIDYRDHGIR 651


>SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein
           S0B|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 287

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 15/54 (27%), Positives = 26/54 (48%)
 Frame = -2

Query: 358 LEYRSQNYPWRRSCHAAIHIL*LSNPSQGFLLL*LSDCTMDSNLFITTDTKRPH 197
           LE R +NY W+R     IHI+ L    +  +L      T+++   +   + RP+
Sbjct: 33  LEVRMENYVWKRRSD-GIHIINLGKTWEKLVLAARVIATIENPADVCVISSRPY 85


>SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1405

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +3

Query: 393 NWNLWTGLLRRTWPARFQRSTQK 461
           NW+    L R  WP  F RS+Q+
Sbjct: 644 NWSSIGRLRRSEWPRSFNRSSQQ 666


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,397,109
Number of Sequences: 5004
Number of extensions: 52046
Number of successful extensions: 168
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 152
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 168
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 271646730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -