SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc...    31   0.11 
SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy...    27   3.1  
SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subun...    26   4.1  

>SPAC1F8.03c |str3||siderophore-iron transporter Str3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 630

 Score = 31.5 bits (68), Expect = 0.11
 Identities = 16/57 (28%), Positives = 26/57 (45%)
 Frame = +3

Query: 240 PHQTFKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNS 410
           PHQ   ++  +LP++          IA  +  NK     R  +PS+ N  +V+N  S
Sbjct: 493 PHQDLAIASSLLPLYTNIGGAIGAAIASPIFSNKVPKYLREYLPSSINDTQVYNFYS 549


>SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 4924

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 237  PPHQTFKMSKMVLPIFDEDDNQFKMTIARHLVGNKER 347
            P H  F  +  ++ +F+++ N+   +IA H V N ++
Sbjct: 1741 PIHTNFDTNADIITLFEKEANEHPSSIALHFVYNVDK 1777


>SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subunit
           Rpc2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1165

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 9/38 (23%), Positives = 17/38 (44%)
 Frame = +1

Query: 94  MPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAY 207
           +P+G  P  +R N+C+ +     +     + P  P  Y
Sbjct: 155 VPIGRMPVMLRSNKCVLSGKNEMEMAALNECPLDPGGY 192


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,622,918
Number of Sequences: 5004
Number of extensions: 51339
Number of successful extensions: 118
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 118
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 291768710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -