SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc...    32   0.097
SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch...    27   2.8  
SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21...    27   3.6  
SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom...    25   8.4  
SPBC21B10.06c |||sequence orphan|Schizosaccharomyces pombe|chr 2...    25   8.4  
SPBC31E1.05 |gle1||RNA export factor Gle1 |Schizosaccharomyces p...    25   8.4  

>SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin
           homolog|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 997

 Score = 31.9 bits (69), Expect = 0.097
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 8/56 (14%)
 Frame = +1

Query: 526 SLIVNGFKYNQVD--------DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYA 669
           +L   GF YN +         D+V C  C     +W +D+     H+T SP C +A
Sbjct: 43  TLATVGFYYNPISESNSEERLDNVTCYMCTKSFYDWEDDDDPLKEHITHSPSCPWA 98



 Score = 25.8 bits (54), Expect = 6.4
 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 3/43 (6%)
 Frame = +1

Query: 502 HCNTAFINSLIVNGFKYN---QVDDHVVCEYCEAEIKNWSEDE 621
           HC  +    +  +GF YN      D   C YC+  + +W  D+
Sbjct: 138 HCEPSV---MAASGFVYNPTADAKDAAHCLYCDINLHDWEPDD 177


>SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit
           Rev3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1480

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 12/50 (24%), Positives = 24/50 (48%)
 Frame = -1

Query: 731 FTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAYSIHSSSDQFFISASQY 582
           F S  ++V+ S  +  + ++    Q    + C Y +H+SS  + I  + Y
Sbjct: 712 FPSCTVLVVNSELELINEVIGLNRQLDPTIVCGYEVHNSSWGYLIERASY 761


>SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit
           Cdc21|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 911

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +2

Query: 47  DDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDV 163
           +D+L +I     K  PF L+    ++ L+ G IDK + +
Sbjct: 267 EDVLNDIELKIYKIRPFNLEKCINMRDLNPGDIDKLISI 305


>SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1692

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +2

Query: 101 LQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTSYISNI 232
           L N T L    N F+   + +  +S+L+  NF  N L+   S I
Sbjct: 524 LVNLTYLDLSYNNFVTFPLIITELSQLETLNFSHNLLSQISSKI 567


>SPBC21B10.06c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 470

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = +1

Query: 109 LHRFEAVEQRVYRQVC 156
           LH FE    RVY Q+C
Sbjct: 180 LHDFETTSNRVYSQIC 195


>SPBC31E1.05 |gle1||RNA export factor Gle1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 480

 Score = 25.4 bits (53), Expect = 8.4
 Identities = 13/53 (24%), Positives = 28/53 (52%)
 Frame = -3

Query: 216 LVSRFILKLNFCNSLIEPTSTDLSINPLLNRFKTV*FCSLKGAHLE*LKEIFF 58
           LV +++L   FC S+++    ++++NP ++ +     C L       LK++ F
Sbjct: 268 LVYKWVLNF-FCKSVVKQAEAEVAVNP-ISAYPLAKVCLLLQTQNADLKDLLF 318


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,792,555
Number of Sequences: 5004
Number of extensions: 54919
Number of successful extensions: 175
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 166
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 175
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 345237368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -