SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|...    28   1.6  
SPAC1952.17c ||SPAC890.01c|GTPase activating protein|Schizosacch...    27   2.1  
SPAC17A2.04c |||HSP chaperone complex subunit |Schizosaccharomyc...    26   6.3  
SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ...    26   6.3  

>SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase
           Rqh1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1328

 Score = 27.9 bits (59), Expect = 1.6
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +3

Query: 306 PYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETIKPKKDLRISVY 464
           P+      +  I  K++ ++ RM      +  F    +F  IKPKKDL   +Y
Sbjct: 681 PFMALTATANEIVKKDIINTLRMENCLELKSSFNRPNLFYEIKPKKDLYTELY 733


>SPAC1952.17c ||SPAC890.01c|GTPase activating
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 619

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 565 KISPVYFRFSWFVCLYS 515
           +I P Y+ F WF CL S
Sbjct: 352 QIHPTYYSFRWFTCLLS 368


>SPAC17A2.04c |||HSP chaperone complex subunit |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 358

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +3

Query: 378 KIYVDREEFYVKTMFETIKPKKDLRISVYLN 470
           K Y D EEFY K + +     KD+ I+ Y N
Sbjct: 78  KRYKDAEEFYTKALAQKC-GDKDIEIACYSN 107


>SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1877

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 19/77 (24%), Positives = 37/77 (48%)
 Frame = -1

Query: 275 LILNKFTASVDLKDTLQFCTPNCVGSNHTKIFPFSNGPKQHSLSI*IEE*DTSAMKSVFT 96
           L++N+F  SVDL +TL+    N   ++   +F       + +L +     +T     +  
Sbjct: 638 LVINRFRYSVDLGETLEVDLENIAKNSPLLVFEDFGSNFESNLEL-----NTVLRTHIEH 692

Query: 95  SVLFCIRSRKGIQVPKL 45
           SV+  I+S   ++VP +
Sbjct: 693 SVISQIKSELLVRVPNI 709


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,945,928
Number of Sequences: 5004
Number of extensions: 60793
Number of successful extensions: 132
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 128
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 132
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 341222980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -