SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_07_0194 + 28327328-28327376,28327699-28327742,28327852-283279...   135   3e-32
01_06_0109 - 26526691-26526775,26526894-26527019,26527228-265273...   133   1e-31
01_01_1031 + 8169505-8169553,8169831-8169905,8170395-8170438,817...   111   4e-25
04_04_0457 + 25359486-25359571,25360690-25360782,25361561-253616...    82   3e-16
10_01_0316 + 3479574-3482679,3482766-3483127                           29   3.4  
10_01_0318 + 3493913-3496976,3497064-3497392                           28   5.9  
07_01_0375 - 2790287-2790675,2790843-2793783                           28   7.8  
05_05_0377 - 24498664-24500215,24500306-24500643                       28   7.8  

>05_07_0194 +
           28327328-28327376,28327699-28327742,28327852-28327961,
           28328250-28328287,28328371-28328448,28328527-28328580,
           28328663-28328764,28329152-28329237,28329327-28329430,
           28329542-28329610,28329689-28329804,28329949-28329983,
           28330152-28330294,28330473-28330598,28330700-28330784
          Length = 412

 Score =  135 bits (327), Expect = 3e-32
 Identities = 57/84 (67%), Positives = 71/84 (84%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR+ W  IK++LIFP++++D  YFDLGLP+RD TDD+VT+++A A LK+NV IKC
Sbjct: 16  DGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPYRDQTDDKVTVEAAEATLKYNVAIKC 75

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV+EF LK MW SPNG
Sbjct: 76  ATITPDEARVKEFSLKSMWKSPNG 99



 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 41/59 (69%), Positives = 49/59 (83%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPI+C++IPR+VPGWTKPI IGRHA GDQY+A D V+  PGK++
Sbjct: 97  PNGTIRNILNGTVFREPIICKNIPRLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKLK 155


>01_06_0109 -
           26526691-26526775,26526894-26527019,26527228-26527370,
           26527521-26527555,26527676-26527791,26527868-26527936,
           26528070-26528173,26528253-26528338,26528429-26528530,
           26528609-26528662,26528763-26528840,26528936-26528973,
           26529235-26529344,26529463-26529506,26530232-26530280
          Length = 412

 Score =  133 bits (322), Expect = 1e-31
 Identities = 57/84 (67%), Positives = 71/84 (84%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTRI W  IK++LIFP++ +D  Y+DLG+ HRDATDD+VT+++A A LK+NV IKC
Sbjct: 16  DGDEMTRIFWQSIKDKLIFPFLDLDIKYYDLGVLHRDATDDKVTVEAAEATLKYNVAIKC 75

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV+EF LK+MW SPNG
Sbjct: 76  ATITPDEARVKEFNLKQMWKSPNG 99



 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 39/59 (66%), Positives = 49/59 (83%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNI+ GTVFREPI+C+++PR+VPGWTKPI IGRHA GDQY+A D V+  PGK++
Sbjct: 97  PNGTIRNIINGTVFREPIICKNVPRLVPGWTKPICIGRHAFGDQYRATDAVLKGPGKLK 155


>01_01_1031 +
           8169505-8169553,8169831-8169905,8170395-8170438,
           8170633-8170742,8170960-8170997,8171055-8171186,
           8171298-8171351,8171424-8171525,8172679-8172764,
           8172870-8172973,8173056-8173124,8173156-8173209,
           8173210-8173325,8173420-8173454,8173637-8173779,
           8174105-8174227,8174305-8174398
          Length = 475

 Score =  111 bits (268), Expect = 4e-25
 Identities = 57/104 (54%), Positives = 70/104 (67%), Gaps = 18/104 (17%)
 Frame = +1

Query: 250 REDGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGI 429
           R  GDEMTR++W  IK++LIFP++ +D  Y+DLGLP+RDAT D+VTI+SA A LK+NV I
Sbjct: 39  RNSGDEMTRVIWKWIKDKLIFPFLDLDIKYYDLGLPNRDATGDKVTIESAEATLKYNVAI 98

Query: 430 KCATITP------------------DEQRVEEFKLKKMWLSPNG 507
           KCATITP                  DE RV+EF L  MW SPNG
Sbjct: 99  KCATITPVLDTQFKFDFGRTIHEPTDEGRVKEFNLSAMWKSPNG 142



 Score = 94.3 bits (224), Expect = 8e-20
 Identities = 40/59 (67%), Positives = 48/59 (81%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPI+C++IPR+VPGW KPI IGRHA GDQY+A D V+  PGK++
Sbjct: 140 PNGTIRNILNGTVFREPIICKNIPRLVPGWIKPICIGRHAFGDQYRATDTVIKGPGKLK 198


>04_04_0457 +
           25359486-25359571,25360690-25360782,25361561-25361622,
           25361758-25361816,25363624-25363733,25364795-25364829,
           25365469-25365546,25365952-25366005,25366277-25366362,
           25366468-25366571,25366986-25367054,25367135-25367250,
           25367387-25367421,25367512-25367654,25367808-25367930,
           25368463-25368556
          Length = 448

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 41/68 (60%), Positives = 50/68 (73%)
 Frame = +1

Query: 304 LIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLK 483
           LIFPY+++D  YFDLGL +RDATDD+VT++SA A L         T+T DE RV+EFKLK
Sbjct: 101 LIFPYLELDVKYFDLGLLNRDATDDKVTVESAEATLDLYSNSFFMTLT-DETRVKEFKLK 159

Query: 484 KMWLSPNG 507
            MW SPNG
Sbjct: 160 SMWRSPNG 167



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +3

Query: 456 TKSRRVQVEENVAKPERKIRNILGGTVFREPILCQSIPRV--VPGWTKPI 599
           T+ +  +++     P   IRNIL GTVFREPILC+++PR+  VP   +P+
Sbjct: 151 TRVKEFKLKSMWRSPNGTIRNILNGTVFREPILCKNVPRILSVPDGAEPV 200


>10_01_0316 + 3479574-3482679,3482766-3483127
          Length = 1155

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +3

Query: 510 IRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQ 641
           +RN+       E +  + I R    W++  VIGR  HG  Y+ +
Sbjct: 843 MRNLDSTEELPEDLTYEDILRATDNWSEKYVIGRGRHGTVYRTE 886


>10_01_0318 + 3493913-3496976,3497064-3497392
          Length = 1130

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +3

Query: 510 IRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQ 641
           +RN+       E +  + I R    W++  VIGR  HG  Y+ +
Sbjct: 829 VRNMDSTEELPEELTYEDILRGTDNWSEKYVIGRGRHGTVYRTE 872


>07_01_0375 - 2790287-2790675,2790843-2793783
          Length = 1109

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = +3

Query: 462 SRRVQVEENVAKPERKIRNILGGTVF-REPILCQSIPRVVPGWTKPIVIGRHAHGDQYKA 638
           S + ++ + V+  ERK     G   F +E I  Q + +V   +++  VIGR A G  YKA
Sbjct: 767 SLKSKIPDLVSNEERKT-GFSGPHYFLKERITFQELMKVTDSFSESAVIGRGACGTVYKA 825


>05_05_0377 - 24498664-24500215,24500306-24500643
          Length = 629

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = -3

Query: 503 FGLSHIFFNLNSSTLCSSGVIVAHLMPTLCF 411
           +  S  +F LN + +C    +   L+PT+C+
Sbjct: 343 YASSECYFGLNLNPMCKPSEVAYTLIPTMCY 373


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,048,905
Number of Sequences: 37544
Number of extensions: 363172
Number of successful extensions: 811
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 791
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 810
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1714968940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -