SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0338 + 16916429-16916650,16916728-16917900                       91   9e-19
02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164,678...    77   9e-15
11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357     76   2e-14
07_03_1061 + 23651404-23651625,23651764-23652954                       76   3e-14
06_03_0500 + 21470681-21470952,21471049-21471089,21472322-214724...    72   4e-13
08_02_0181 + 13923658-13923661,13925518-13925681,13925879-139259...    71   6e-13
07_01_0182 + 1280479-1280754,1281232-1282089                           71   8e-13
02_05_0796 + 31800256-31800528,31800635-31800758,31802642-318027...    71   8e-13
06_03_0794 - 24671955-24672362,24672469-24672505,24672804-246728...    68   7e-12
08_02_1101 - 24308433-24308978,24309195-24309364,24309443-243095...    64   9e-11
07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637           64   9e-11
03_06_0105 + 31675083-31675313,31676171-31676815                       64   9e-11
01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442     64   1e-10
01_06_1533 + 38041499-38041681,38041853-38041985,38042816-380429...    64   1e-10
03_05_0630 + 26260159-26260272,26260520-26260894                       62   5e-10
03_02_0346 - 7666500-7666646,7666744-7666902                           62   5e-10
06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622...    60   1e-09
01_05_0696 - 24366857-24368200                                         60   1e-09
12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732...    60   2e-09
12_02_1219 + 27096477-27096590,27096704-27097078                       59   3e-09
01_06_1799 + 39948481-39948607,39948694-39948762,39948859-399489...    59   3e-09
01_06_0833 + 32296957-32297256,32299257-32299895                       59   3e-09
03_06_0587 - 34921535-34922041,34922579-34922689                       58   4e-09
03_01_0293 - 2258647-2258754,2258861-2259085                           58   4e-09
01_01_1143 - 9064210-9065682                                           58   4e-09
04_04_1294 - 32424762-32426309                                         56   2e-08
03_02_0613 - 9848514-9848539,9848942-9849200,9849326-9849365,984...    56   2e-08
02_05_0506 + 29613307-29613601,29613641-29613678,29613679-296138...    55   5e-08
07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584...    54   7e-08
03_02_0472 - 8737955-8738580,8738704-8738767,8739090-8739239,873...    54   1e-07
04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890     53   2e-07
02_05_1206 + 34941293-34941562,34942052-34942153,34942249-349425...    53   2e-07
01_07_0160 - 41563109-41563468,41563566-41563985,41564082-415642...    53   2e-07
09_06_0308 - 22199389-22199451,22199604-22199924,22200178-222004...    52   4e-07
08_02_1559 - 27873345-27873407,27873549-27873830,27874162-278742...    50   1e-06
07_03_1378 + 26158233-26158562,26159075-26159176,26159551-261598...    50   1e-06
03_06_0523 + 34499533-34499705,34499808-34499917,34500037-345002...    50   1e-06
03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800           50   1e-06
06_03_1455 + 30264023-30264174,30265930-30266070,30266328-302664...    50   2e-06
05_03_0022 + 7452234-7452389,7452955-7453113                           50   2e-06
11_02_0073 - 8020401-8020512,8020594-8020679,8020761-8020921,802...    50   2e-06
10_05_0029 - 8319233-8319408,8319516-8319584,8319754-8319838,832...    49   4e-06
07_01_0286 + 2086630-2086856,2087052-2087067                           49   4e-06
03_02_0558 - 9459745-9459980,9460089-9460157,9460630-9460846           49   4e-06
05_03_0025 + 7462272-7462412,7462865-7463032                           48   5e-06
03_06_0728 + 35768830-35769324,35769404-35769462,35770440-357705...    48   5e-06
01_04_0003 - 14989160-14989445,14989673-14989807,14991418-149915...    48   5e-06
10_08_0254 + 16236689-16236793,16237760-16237808,16237988-162380...    48   8e-06
04_04_0674 + 27173948-27174188,27174704-27175260,27175310-271753...    47   1e-05
09_02_0211 - 5817564-5817578,5817711-5818040,5818095-5818196,581...    47   1e-05
08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-94...    47   1e-05
03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247...    47   1e-05
10_01_0298 - 3094197-3094307,3095093-3095253,3095462-3095666,309...    46   2e-05
05_03_0023 + 7457836-7457976,7458313-7458480                           46   2e-05
04_04_0435 - 25170348-25170593,25170989-25171189,25171580-251717...    46   2e-05
03_03_0130 - 14699658-14699723,14699828-14700109,14700444-147005...    46   2e-05
02_05_0810 - 31934965-31935013,31935096-31935217,31935328-319355...    46   2e-05
07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428...    46   3e-05
03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750,395...    46   3e-05
02_05_0627 + 30463452-30463774,30463841-30463956,30464125-304643...    46   3e-05
02_04_0518 + 23601355-23602498,23603481-23603779                       46   3e-05
08_02_0526 + 18184146-18184168,18184247-18184438,18184846-181849...    46   3e-05
06_01_0815 + 6166861-6166953,6167074-6167173,6168569-6168639,616...    46   3e-05
05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-76...    45   4e-05
09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801,116...    45   6e-05
07_01_0280 + 2064865-2065080,2065442-2065531,2065690-2065893           45   6e-05
02_05_1014 + 33510108-33510471,33510857-33511362                       45   6e-05
08_01_0268 - 2167639-2167764,2167887-2167937,2169126-2169167,216...    44   8e-05
11_06_0728 + 26717018-26717306,26717494-26717598,26717789-267178...    44   1e-04
11_06_0490 - 24293218-24293373,24293454-24293521,24293845-242939...    44   1e-04
08_02_1084 - 24232968-24234779                                         44   1e-04
08_01_0620 - 5416197-5416225,5416333-5416652,5417144-5417235,541...    44   1e-04
07_03_0824 + 21769569-21769689,21770891-21770959,21771047-217711...    44   1e-04
06_03_1263 + 28828048-28828347                                         44   1e-04
11_06_0418 - 23317077-23317343,23317614-23317787,23317886-233179...    43   2e-04
08_02_1064 - 24033941-24034127,24034432-24034476,24035355-240354...    43   2e-04
07_01_0413 - 3155080-3155274,3155628-3155933,3156062-3156163,315...    43   2e-04
05_04_0101 - 18003528-18003655,18003951-18003997,18004046-180040...    43   2e-04
03_06_0507 + 34404843-34404968,34405091-34405151,34405260-344052...    43   2e-04
02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182...    43   2e-04
09_04_0506 - 18188785-18190599                                         42   3e-04
04_04_1121 - 31041629-31041793,31041891-31042022,31042255-310424...    42   3e-04
03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594     42   3e-04
01_07_0362 + 43063345-43063420,43064176-43064244,43064348-430644...    42   3e-04
01_07_0120 + 41185884-41186127,41187228-41187310,41188596-411886...    42   3e-04
04_04_0176 - 23329589-23331043                                         42   4e-04
07_03_1316 + 25736931-25737206,25737276-25737329,25738036-257381...    42   5e-04
04_03_0282 - 13874547-13874738,13875047-13875134,13875222-138753...    42   5e-04
03_03_0192 - 15308602-15308869,15309457-15309528,15310271-153103...    42   5e-04
08_02_0162 + 13464698-13464974,13465719-13465837,13465920-134665...    41   7e-04
06_01_0493 - 3536207-3537056,3537603-3537826,3538234-3538503,353...    41   7e-04
05_04_0092 + 17851085-17851346,17852778-17852860,17853891-178539...    41   7e-04
04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916...    41   7e-04
03_05_0235 - 22214700-22214914,22218782-22219045,22219258-22219294     41   7e-04
01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187...    41   7e-04
11_01_0236 + 1811822-1812971,1814930-1814979,1815676-1816116,181...    41   0.001
09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174...    41   0.001
07_03_1586 - 27929947-27930056,27930143-27930286,27930377-279307...    41   0.001
07_01_1143 - 10711023-10711884,10713603-10713826,10714253-107145...    41   0.001
05_04_0383 - 20801036-20801309,20801413-20801538,20801706-208017...    40   0.001
03_05_0067 - 20460206-20460703,20461255-20461530                       40   0.001
02_05_1015 + 33512023-33512359,33513550-33514082                       40   0.001
02_02_0008 + 6061508-6061624,6062468-6062566,6062636-6063039,606...    40   0.001
12_01_0234 + 1755704-1756120,1756203-1756313,1756923-1757063,175...    40   0.002
04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276     40   0.002
02_01_0251 - 1652356-1652522,1652564-1652608,1652658-1652733,165...    40   0.002
08_02_0651 - 19714348-19714395,19715319-19715429,19715503-197155...    39   0.003
02_04_0589 - 24117688-24119282,24119881-24119908,24120004-241200...    39   0.003
09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474...    39   0.004
08_01_0098 - 700443-700660,701112-701268,701586-701678,701763-70...    39   0.004
03_02_0967 + 12786219-12786305,12786716-12786781,12786897-127869...    39   0.004
09_06_0188 - 21441377-21442201                                         38   0.005
02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147,362...    38   0.005
06_03_0614 - 22753092-22753349,22754059-22754277,22754712-227549...    38   0.007
01_06_0834 + 32302065-32302143,32303136-32303275,32303371-323034...    38   0.007
06_01_1003 - 7798800-7799444                                           38   0.009
06_01_0991 + 7704063-7704707                                           38   0.009
05_04_0028 + 17302359-17302445,17303887-17303952,17305415-173054...    38   0.009
04_04_1188 + 31579833-31579914,31580001-31580176,31580822-315809...    38   0.009
03_03_0117 - 14583102-14583186,14585202-14585336,14585440-145856...    38   0.009
05_01_0290 + 2270749-2271037,2272227-2272363,2272660-2272805,227...    37   0.012
02_04_0661 - 24802868-24802921,24803004-24803089,24803178-248032...    37   0.012
03_02_0555 + 9431451-9431688,9432685-9432803,9432886-9433079,943...    37   0.015
08_02_1039 - 23866743-23866862,23866985-23867266,23867868-238679...    36   0.020
07_03_0600 + 19866757-19867218,19867920-19868429                       36   0.020
03_04_0091 + 17241555-17241602,17241685-17241822,17241901-172421...    36   0.020
08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526...    36   0.027
12_02_0849 - 23640091-23640279,23640537-23640677,23640756-236422...    36   0.036
11_08_0081 - 28216179-28216381,28216590-28216657,28217131-282172...    36   0.036
05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98...    36   0.036
11_06_0326 - 22382001-22383248                                         35   0.047
10_08_0154 + 15266430-15266953,15267748-15267820,15267893-152679...    35   0.047
09_04_0716 + 19702100-19702250,19702366-19702463,19702527-197026...    35   0.047
08_02_1098 - 24291138-24291851,24292607-24292861                       35   0.047
04_04_0979 - 29862280-29862444,29862718-29862999,29863831-298639...    35   0.062
02_02_0387 - 9606744-9607475                                           35   0.062
01_07_0248 + 42261373-42261609,42261733-42261905,42261986-422620...    35   0.062
07_03_1654 - 28416487-28416548,28416791-28416824,28418156-284182...    34   0.11 
09_04_0736 - 19815427-19815642,19815782-19816903,19817006-198177...    33   0.14 
04_01_0107 - 1107976-1108033,1108411-1108638,1110109-1110422,111...    33   0.19 
01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298...    33   0.19 
04_04_0946 - 29579779-29580004,29580098-29580210                       33   0.25 
04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066     33   0.25 
10_01_0076 - 987092-987671,987747-987812,988201-988363,988467-98...    28   0.27 
12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663...    32   0.33 
07_03_1347 + 25932185-25932748,25933151-25933755,25935797-259362...    32   0.33 
05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28...    32   0.33 
02_02_0284 - 8547126-8547187,8547306-8547395,8547810-8547861,854...    32   0.33 
04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956...    32   0.44 
03_03_0042 + 14009649-14009866,14011342-14011419,14011791-140119...    32   0.44 
02_05_1020 - 33561454-33561568,33561839-33562070,33563286-335633...    32   0.44 
01_06_1531 + 38024757-38024790,38025592-38025803,38026111-380262...    32   0.44 
10_02_0023 + 4306350-4306908,4308429-4308814,4308917-4308991,430...    31   0.58 
07_03_1709 - 28873172-28873327,28873519-28873584,28874067-288741...    31   0.58 
06_01_0613 + 4439829-4439917,4440650-4440738,4441219-4441453,444...    31   0.58 
03_02_0874 + 12017069-12018051,12018137-12018316,12018421-120186...    31   0.58 
12_02_0846 - 23623624-23623784,23624076-23624258,23624601-236246...    31   0.77 
07_01_0284 - 2082249-2082256,2082496-2083009                           31   0.77 
08_02_1176 + 24931728-24931877,24933175-24933275,24934410-249347...    31   1.0  
03_05_0066 - 20455976-20456161,20456251-20456347,20456608-204567...    31   1.0  
02_04_0577 - 24011542-24011906,24012285-24012385,24013029-240132...    31   1.0  
05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347,361...    30   1.3  
02_01_0598 + 4440018-4440070,4440627-4440693,4440794-4440926,444...    30   1.3  
10_08_0747 - 20272157-20272456,20272538-20272664,20272770-202728...    30   1.8  
10_07_0126 - 13143485-13144117,13144204-13145238                       30   1.8  
07_03_1711 + 28909297-28909329,28909725-28910204,28910300-289104...    30   1.8  
07_03_1651 - 28395369-28395436,28395524-28395575,28395857-283960...    30   1.8  
02_05_0544 + 29876337-29876524,29876850-29876882,29878390-298785...    30   1.8  
02_01_0304 + 2037718-2037939,2038169-2038384,2038862-2039329,203...    30   1.8  
08_01_0181 + 1530623-1531626,1531723-1531902,1531998-1532177,153...    29   2.3  
07_03_1389 + 26212117-26212119,26212721-26212875,26213402-262134...    29   2.3  
03_05_0905 - 28665838-28666422,28667073-28667156,28667335-286674...    29   2.3  
06_03_1076 + 27409107-27409204,27409731-27409835,27409915-274100...    29   3.1  
04_04_1223 + 31851545-31852609,31854314-31854773,31856201-318562...    29   3.1  
11_01_0002 + 3386-3541,3619-3717,4114-4182,4275-4459,4662-4677         29   4.1  
08_01_0272 + 2200061-2200078,2200835-2202076,2202201-2202698,220...    29   4.1  
06_03_1075 + 27399279-27399376,27399449-27399555,27400791-274008...    28   5.4  
03_02_0596 + 9714022-9714065,9714799-9714868,9714978-9715883,971...    28   7.1  
01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178     28   7.1  
11_06_0289 - 21969248-21973516                                         27   9.4  
11_06_0185 + 21018045-21022307                                         27   9.4  
04_04_1001 - 30020380-30021045,30021127-30021210,30022091-300221...    27   9.4  
01_06_0952 - 33310262-33310273,33310468-33311142                       27   9.4  

>10_08_0338 + 16916429-16916650,16916728-16917900
          Length = 464

 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 39/78 (50%), Positives = 54/78 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GG+SWETT+++LRDHF AYG++    V  D  TGR RGF F+VF  P S+D  +  
Sbjct: 7   KLFIGGISWETTEEKLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAAL-V 65

Query: 190 GEHTINNKKVDPKKAKAR 243
             HT++ + VD K+A +R
Sbjct: 66  DPHTLDGRTVDVKRALSR 83



 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 34/90 (37%), Positives = 56/90 (62%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G + T + FVGGL S +++DE R +F  +G + +V + +D+   + +GF FITF++E  V
Sbjct: 123 GGARTKKIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAV 182

Query: 411 NDLLKTPKRTIGGKEVDVKRATPKPDGPGA 500
           + +L      + GK V+VKRA P+   PG+
Sbjct: 183 DRVLHKTFHDLSGKMVEVKRALPREANPGS 212



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGL    T+ E R +F  YG +  + V  D NT R RGF FI F A +++D+V
Sbjct: 126 RTKKIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRV 185

Query: 181 MAAGEHTINNKKVDPKKAKAR 243
           +    H ++ K V+ K+A  R
Sbjct: 186 LHKTFHDLSGKMVEVKRALPR 206



 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 26/82 (31%), Positives = 47/82 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+S E +++++R+ F+ +G + +  +  DK   + +GF F+ F     V+  L  P 
Sbjct: 9   FIGGISWETTEEKLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVDAALVDP- 67

Query: 435 RTIGGKEVDVKRATPKPDGPGA 500
            T+ G+ VDVKRA  + +   A
Sbjct: 68  HTLDGRTVDVKRALSREEQQAA 89


>02_02_0100 -
           6783821-6784339,6784815-6784984,6785062-6785164,
           6785291-6785454,6786781-6786821,6786933-6787129
          Length = 397

 Score = 77.4 bits (182), Expect = 9e-15
 Identities = 38/96 (39%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           ++E   K+G  T  + FVGGL S +++DE+R  FS +G I+E ++  D +  + +GF F+
Sbjct: 143 REEMSSKDGPKTR-KIFVGGLPSSLTEDELREHFSPYGKIVEHQIMLDHSTGRSRGFGFV 201

Query: 387 TFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDG 491
           TFESE  V  ++   + R +GGK+V++K+A PK  G
Sbjct: 202 TFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHG 237



 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 35/82 (42%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL    T+ ELR+HF  YG+I    +  D +TGRSRGF F+ F++ +S+++V++ 
Sbjct: 156 KIFVGGLPSSLTEDELREHFSPYGKIVEHQIMLDHSTGRSRGFGFVTFESEDSVERVISE 215

Query: 190 GE-HTINNKKVDPKKAK-ARHG 249
           G    +  K+V+ KKA+  +HG
Sbjct: 216 GRMRDLGGKQVEIKKAEPKKHG 237



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 32/78 (41%), Positives = 45/78 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG++WETT++    HF  YG I    +  D +T   RGF F+ F  P  IDKV+  
Sbjct: 67  KIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVL-E 125

Query: 190 GEHTINNKKVDPKKAKAR 243
            EH I+ + V+ K+   R
Sbjct: 126 DEHVIDGRTVEVKRTVPR 143



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/78 (30%), Positives = 44/78 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG++ E +++     F ++G I +  +  DK     +GF F+TF    V++ +L+  +
Sbjct: 69  FVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVLE-DE 127

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+VKR  P+ +
Sbjct: 128 HVIDGRTVEVKRTVPREE 145


>11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357
          Length = 481

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 37/89 (41%), Positives = 55/89 (61%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G S T + FVGGL+S +++ + R +F +FGTI +V + +D    + +GF FIT++SE  V
Sbjct: 115 GPSRTKKIFVGGLASTVTEADFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAV 174

Query: 411 NDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           +  L      + GK V+VKRA PK   PG
Sbjct: 175 DKALFKTFHELNGKMVEVKRAVPKELSPG 203



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 29/70 (41%), Positives = 45/70 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+GG+SW+T +  LR++F  YGE+    +  D  TGR+RGF FIVF  P   ++V+  
Sbjct: 7   KLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVFADPAVAERVIME 66

Query: 190 GEHTINNKKV 219
            +H I+ + +
Sbjct: 67  -KHMIDGRMI 75



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 30/78 (38%), Positives = 47/78 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R +K+FVGGL+   T+ + R +F  +G I  + V  D NT R RGF FI + + +++DK 
Sbjct: 118 RTKKIFVGGLASTVTEADFRKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKA 177

Query: 181 MAAGEHTINNKKVDPKKA 234
           +    H +N K V+ K+A
Sbjct: 178 LFKTFHELNGKMVEVKRA 195



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/68 (27%), Positives = 40/68 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GG+S + ++D +R +F ++G ++E  +  D+   + +GF FI F ++  V + +   K
Sbjct: 9   FIGGISWDTNEDRLREYFDKYGEVVEAVIMRDRATGRARGFGFIVF-ADPAVAERVIMEK 67

Query: 435 RTIGGKEV 458
             I G+ +
Sbjct: 68  HMIDGRMI 75


>07_03_1061 + 23651404-23651625,23651764-23652954
          Length = 470

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 36/89 (40%), Positives = 53/89 (59%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G   T + FVGGL+S +++ E R +F +FG I +V + +D    + +GF FIT++SE  V
Sbjct: 101 GPGRTRKIFVGGLASNVTEVEFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAV 160

Query: 411 NDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           +  L      + GK V+VKRA PK   PG
Sbjct: 161 DKALHKNFHELNGKMVEVKRAVPKEQSPG 189



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/78 (43%), Positives = 49/78 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGG+SWET +  LR++F  +GE+    +  D NTGR+RGF F+VF      ++V   
Sbjct: 7   KLFVGGISWETDEDRLREYFSRFGEVTEAVIMRDRNTGRARGFGFVVFTDAGVAERV-TM 65

Query: 190 GEHTINNKKVDPKKAKAR 243
            +H I+ + V+ KKA  R
Sbjct: 66  DKHMIDGRMVEAKKAVPR 83



 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 31/78 (39%), Positives = 46/78 (58%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  K+FVGGL+   T+ E R +F  +G I  + V  D NT R RGF FI + + +++DK 
Sbjct: 104 RTRKIFVGGLASNVTEVEFRRYFEQFGVITDVVVMYDHNTQRPRGFGFITYDSEDAVDKA 163

Query: 181 MAAGEHTINNKKVDPKKA 234
           +    H +N K V+ K+A
Sbjct: 164 LHKNFHELNGKMVEVKRA 181



 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 27/78 (34%), Positives = 45/78 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+S E  +D +R +FS FG + E  +  D+   + +GF F+ F ++  V + +   K
Sbjct: 9   FVGGISWETDEDRLREYFSRFGEVTEAVIMRDRNTGRARGFGFVVF-TDAGVAERVTMDK 67

Query: 435 RTIGGKEVDVKRATPKPD 488
             I G+ V+ K+A P+ D
Sbjct: 68  HMIDGRMVEAKKAVPRDD 85


>06_03_0500 +
           21470681-21470952,21471049-21471089,21472322-21472485,
           21472577-21472679,21472806-21472975,21473766-21474239
          Length = 407

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG++WETT++    HF  YG I    +  D +T   RGF F+ F  P  IDKV+  
Sbjct: 92  KIFVGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTKMPRGFGFVTFSDPSVIDKVL-Q 150

Query: 190 GEHTINNKKVDPKKAKAR 243
            EHTI+ + V+ K+   R
Sbjct: 151 DEHTIDGRTVEVKRTVPR 168



 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 30/79 (37%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+    T+ +L++HF +YG++    +  D  TGRSRGF F+ F+  +++++VM+ 
Sbjct: 181 KIFVGGIPPSLTEDKLKEHFSSYGKVVEHQIMLDHGTGRSRGFGFVTFENEDAVERVMSE 240

Query: 190 GE-HTINNKKVDPKKAKAR 243
           G  H +  K+V+ KKA+ +
Sbjct: 241 GRMHDLAGKQVEIKKAEPK 259



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 31/98 (31%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           ++E   K+G  T  + FVGG+   +++D+++  FS +G ++E ++  D    + +GF F+
Sbjct: 168 REEMSSKDGPKTR-KIFVGGIPPSLTEDKLKEHFSSYGKVVEHQIMLDHGTGRSRGFGFV 226

Query: 387 TFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 497
           TFE+E  V  ++   +   + GK+V++K+A PK  G G
Sbjct: 227 TFENEDAVERVMSEGRMHDLAGKQVEIKKAEPKKPGGG 264



 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 27/87 (31%), Positives = 50/87 (57%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           EG  ++ + FVGG++ E +++     F ++G I +  +  DK     +GF F+TF    V
Sbjct: 85  EGGDSSGKIFVGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTKMPRGFGFVTFSDPSV 144

Query: 408 VNDLLKTPKRTIGGKEVDVKRATPKPD 488
           ++ +L+  + TI G+ V+VKR  P+ +
Sbjct: 145 IDKVLQ-DEHTIDGRTVEVKRTVPREE 170


>08_02_0181 +
           13923658-13923661,13925518-13925681,13925879-13925978,
           13926072-13926244,13926486-13927016
          Length = 323

 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 34/83 (40%), Positives = 55/83 (66%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL--KT 428
           FVGGL S + +DE + FFS+FG ++E E+  D + N+ +GF F+ F++E+ V++LL  K 
Sbjct: 79  FVGGLPSALKEDEFKEFFSKFGKVVEHEIIRDHSTNRSRGFGFVVFDAEKTVDELLAKKG 138

Query: 429 PKRTIGGKEVDVKRATP-KPDGP 494
               + G +V++K+A P KP  P
Sbjct: 139 NMIDLNGSQVEIKKAEPKKPSNP 161



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 2/81 (2%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL     + E ++ F  +G++    +  D +T RSRGF F+VF A +++D+++A
Sbjct: 76  KKIFVGGLPSALKEDEFKEFFSKFGKVVEHEIIRDHSTNRSRGFGFVVFDAEKTVDELLA 135

Query: 187 AGEHTI--NNKKVDPKKAKAR 243
              + I  N  +V+ KKA+ +
Sbjct: 136 KKGNMIDLNGSQVEIKKAEPK 156



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 23/58 (39%), Positives = 34/58 (58%)
 Frame = +1

Query: 58  RDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 231
           +++FG YGEI    +  D  T + RGF FI F  P  +D+V+    H IN K+V+ K+
Sbjct: 5   KEYFGKYGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRVI-EDNHVINGKEVEIKR 61



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = +3

Query: 297 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 476
           + +F ++G I++  +  D+   + +GF FITF    VV+ +++     I GKEV++KR  
Sbjct: 5   KEYFGKYGEIVDAVIMKDRFTQKPRGFGFITFADPAVVDRVIE-DNHVINGKEVEIKRTI 63

Query: 477 PKPDGP 494
           PK   P
Sbjct: 64  PKGAAP 69


>07_01_0182 + 1280479-1280754,1281232-1282089
          Length = 377

 Score = 70.9 bits (166), Expect = 8e-13
 Identities = 35/81 (43%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGG+     + ELR HFG YG + S+ V  D  TG  RGF F+ F+  E   + +  
Sbjct: 21  KLFVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGD 80

Query: 190 GE---HTINNKKVDPKKAKAR 243
           GE   H I  + VD K+A+AR
Sbjct: 81  GEHPRHLICGRVVDVKRARAR 101



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 27/76 (35%), Positives = 47/76 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL   I+++E + +F  FGT+ +V + +D   N+ +GF F+TF+SE+ V  +++   
Sbjct: 147 FIGGLRDNITEEEFKTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEHSF 206

Query: 435 RTIGGKEVDVKRATPK 482
             + G  V+ K A PK
Sbjct: 207 HDLKGTRVEAKIAIPK 222



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+F+GGL    T++E + +F ++G +  + V  D  T RSRGF F+ F + E++ KV+ 
Sbjct: 144 KKVFIGGLRDNITEEEFKTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIE 203

Query: 187 AGEHTINNKKVDPKKA 234
              H +   +V+ K A
Sbjct: 204 HSFHDLKGTRVEAKIA 219



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 3/80 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL---K 425
           FVGG+ +   + E+R  F ++G +  V +  DK     +GF F+ FE E+     L   +
Sbjct: 23  FVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARALGDGE 82

Query: 426 TPKRTIGGKEVDVKRATPKP 485
            P+  I G+ VDVKRA  +P
Sbjct: 83  HPRHLICGRVVDVKRARARP 102


>02_05_0796 +
           31800256-31800528,31800635-31800758,31802642-31802771,
           31804336-31804414,31804848-31805133,31805273-31805385
          Length = 334

 Score = 70.9 bits (166), Expect = 8e-13
 Identities = 32/71 (45%), Positives = 44/71 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET  K L+DHF  YGEI    V TD  T RS+G+ F+ F+ PES  + +  
Sbjct: 47  KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRN 106

Query: 190 GEHTINNKKVD 222
              TI  ++ +
Sbjct: 107 PNPTIGGRRAN 117



 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 28/92 (30%), Positives = 50/92 (54%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           R + G +T  + FVGGL+ E     +++ F ++G ILE  +  D+  ++ KG+ F+TF  
Sbjct: 37  RTRFGDTTLTKVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFRE 96

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
            +   + ++ P  TIGG+  +   A+  P  P
Sbjct: 97  PESAREAVRNPNPTIGGRRANCNIASMGPPRP 128


>06_03_0794 -
           24671955-24672362,24672469-24672505,24672804-24672858,
           24674044-24674167,24674670-24674903
          Length = 285

 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 30/55 (54%), Positives = 39/55 (70%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + K+FVGGL+WET  + LR HF AYGEI    V TD  TGRS+G+ F+ F+ P+S
Sbjct: 32  YTKVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDS 86



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R  F  +G ILE  +  D+   + KG+ F+TF      
Sbjct: 28  GDTTYTKVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDSA 87

Query: 411 NDLLKTPKRTIGGKEVDVKRA---TPKPDGPGA 500
                 P   I G+  +   A    P PD P A
Sbjct: 88  RMACMDPYPVIDGRRANCNLAILGRPGPDIPFA 120


>08_02_1101 -
           24308433-24308978,24309195-24309364,24309443-24309542,
           24310337-24310500,24310960-24310996,24311222-24311262,
           24313877-24314093
          Length = 424

 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 28/77 (36%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   +++D+ ++FF ++G +++ ++  D    + +GF FI F S+QVV+DLL    
Sbjct: 176 FVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGN 235

Query: 435 R-TIGGKEVDVKRATPK 482
              + G +V++K+A PK
Sbjct: 236 MIDLAGAKVEIKKAEPK 252



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL    T+ + +  F  YG +    +  D  T RSRGF FIVF + + +D ++A
Sbjct: 173 KKIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLA 232

Query: 187 AGEH-TINNKKVDPKKAKAR 243
            G    +   KV+ KKA+ +
Sbjct: 233 NGNMIDLAGAKVEIKKAEPK 252



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 24/65 (36%), Positives = 35/65 (53%)
 Frame = +1

Query: 37  ETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 216
           E  + +   HFG YGEI    +  D +T + RGF FI +  P  +D+VM    H  N K+
Sbjct: 95  EPDEADFVKHFGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRVM-DDIHEFNGKQ 153

Query: 217 VDPKK 231
           V+ K+
Sbjct: 154 VEIKR 158



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 306 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           F ++G I++  +  DK  +Q +GF FIT+ +  VV D +        GK+V++KR  PK
Sbjct: 105 FGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVV-DRVMDDIHEFNGKQVEIKRTIPK 162


>07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637
          Length = 309

 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 3/81 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGE-IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++FVGGLSW+TT++ L   F  YG+ IE+  V  + +TGRSRGF F+ F  P ++D  + 
Sbjct: 8   RIFVGGLSWDTTERTLERAFSEYGKVIETQMVVLERDTGRSRGFGFVTFSEPRAVDAAI- 66

Query: 187 AGEHT--INNKKVDPKKAKAR 243
            G H   ++ + +   KA+ R
Sbjct: 67  RGMHNGELDGRTISVNKAQPR 87



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 2/78 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM-PFDKTKNQRKGFCFITFESEQVVNDLLK-T 428
           FVGGLS + ++  +   FSE+G ++E +M   ++   + +GF F+TF   + V+  ++  
Sbjct: 10  FVGGLSWDTTERTLERAFSEYGKVIETQMVVLERDTGRSRGFGFVTFSEPRAVDAAIRGM 69

Query: 429 PKRTIGGKEVDVKRATPK 482
               + G+ + V +A P+
Sbjct: 70  HNGELDGRTISVNKAQPR 87


>03_06_0105 + 31675083-31675313,31676171-31676815
          Length = 291

 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV GL  +T + +LR HF  YGE+    V  D  +G SRGF F+ F    +  + +A 
Sbjct: 6   KLFVAGLPQQTREGDLRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRALAD 65

Query: 190 GE---HTINNKKVDPKKAKARH 246
            E   H    +KVD K+A+ RH
Sbjct: 66  DEMPNHVFRGRKVDVKRAERRH 87



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/76 (35%), Positives = 48/76 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   ++  ++ ++F +FGTI +  +  ++T N+ +GF FI+F+S + V  +L    
Sbjct: 115 FVGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLNRF 174

Query: 435 RTIGGKEVDVKRATPK 482
             + G++V+VK A PK
Sbjct: 175 HNLNGRDVEVKIAVPK 190



 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+FVGGL    T K+L  +F  +G I    V  +  T R+RGF FI F + E++ K++ 
Sbjct: 112 KKVFVGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILL 171

Query: 187 AGEHTINNKKVDPKKA 234
              H +N + V+ K A
Sbjct: 172 NRFHNLNGRDVEVKIA 187



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL---K 425
           FV GL  +  + ++R  F+ +G ++   +  D      +GF F+ F  E      L   +
Sbjct: 8   FVAGLPQQTREGDLRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRALADDE 67

Query: 426 TPKRTIGGKEVDVKRATPKPD 488
            P     G++VDVKRA  + D
Sbjct: 68  MPNHVFRGRKVDVKRAERRHD 88


>01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442
          Length = 151

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           K+FVGGL+WET  + +R +F  +G+I    V TD NTGRS+G+ F+ F+ PE+  K
Sbjct: 22  KVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAAMK 77



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R +F +FG ILE  +  DK   + KG+ F+TF   +  
Sbjct: 16  GDTTLTKVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAA 75

Query: 411 NDLLKTPKRTIGGKEVDVKRA 473
                 P   I G+  +   A
Sbjct: 76  MKACFDPYPVIDGRRANCNLA 96


>01_06_1533 +
           38041499-38041681,38041853-38041985,38042816-38042954,
           38043331-38043367,38045606-38045897,38046384-38046502
          Length = 300

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 26/55 (47%), Positives = 39/55 (70%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + K+FVGGL+WET  + +R +F  +GEI    V TD NTGRS+G+ F+ F+ P++
Sbjct: 15  YTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPDA 69



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/82 (31%), Positives = 40/82 (48%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVV 410
           G +T  + FVGGL+ E   + +R +F +FG ILE  +  DK   + KG+ F+TF      
Sbjct: 11  GDTTYTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDKNTGRSKGYGFVTFRDPDAA 70

Query: 411 NDLLKTPKRTIGGKEVDVKRAT 476
                 P   I G+  +   A+
Sbjct: 71  MRACVDPAPVIDGRRANCNLAS 92


>03_05_0630 + 26260159-26260272,26260520-26260894
          Length = 162

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           + FVGGL+W T D+ L   F  YGEI    +  D  TGRSRGF F+ F + +S+ D +  
Sbjct: 9   RCFVGGLAWATDDRSLEAAFSTYGEILDSKIINDRETGRSRGFGFVTFSSEQSMRDAIEG 68

Query: 187 AGEHTINNKKVDPKKAKAR 243
                ++ + +   +A++R
Sbjct: 69  MNGKELDGRNITVNEAQSR 87



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    D  +   FS +G IL+ ++  D+   + +GF F+TF SEQ + D ++   
Sbjct: 11  FVGGLAWATDDRSLEAAFSTYGEILDSKIINDRETGRSRGFGFVTFSSEQSMRDAIEGMN 70

Query: 435 -RTIGGKEVDVKRATPKPDGPG 497
            + + G+ + V  A  +  G G
Sbjct: 71  GKELDGRNITVNEAQSRRSGGG 92


>03_02_0346 - 7666500-7666646,7666744-7666902
          Length = 101

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 27/71 (38%), Positives = 41/71 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGL WET    +R HF  +GEI    V  D +TGRS+G+ F+ F+ P+   + +  
Sbjct: 9   KLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADKHTGRSKGYGFVTFRDPDGAARALQD 68

Query: 190 GEHTINNKKVD 222
               I+ ++ +
Sbjct: 69  PTPVIDGRRAN 79



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 27/82 (32%), Positives = 40/82 (48%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           +G +T  + FVGGL  E   D +R  F +FG I+E  +  DK   + KG+ F+TF     
Sbjct: 2   DGDTTFTKLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADKHTGRSKGYGFVTFRDPDG 61

Query: 408 VNDLLKTPKRTIGGKEVDVKRA 473
               L+ P   I G+  +   A
Sbjct: 62  AARALQDPTPVIDGRRANCNLA 83


>06_01_0824 -
           6219477-6219556,6220427-6220808,6221415-6221448,
           6222214-6222370,6224449-6224575,6224663-6224914
          Length = 343

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 27/53 (50%), Positives = 35/53 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           K+FVGGL+WET  + LR HF  YGEI    V  D  TGRS+G+ F+ F+  E+
Sbjct: 40  KVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFREAEA 92



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 27/92 (29%), Positives = 46/92 (50%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           R + G +T  + FVGGL+ E   + +R  F ++G ILE  +  D+   + KG+ F+TF  
Sbjct: 30  RSRFGDTTLTKVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFRE 89

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
            +     ++ P   I G+  +   A+  P  P
Sbjct: 90  AEAARRAVQDPNPMIAGRRANCNIASLGPPRP 121


>01_05_0696 - 24366857-24368200
          Length = 447

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 32/71 (45%), Positives = 44/71 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV GL WET    LR  F A+G++E   V TD +TGRS+G+ F+ F+  +S   V+A 
Sbjct: 77  KLFVRGLGWETNSDSLRAIFSAFGDLEEAVVITDKSTGRSKGYGFVTFRHADS--AVLAL 134

Query: 190 GEHTINNKKVD 222
            E    +KK+D
Sbjct: 135 KE---PSKKID 142



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 31/82 (37%), Positives = 42/82 (51%), Gaps = 6/82 (7%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES-----ID 174
           K+FVG +  +   + L  HF AYGEIE   +  D  TG+ RGFA  V+K PE      +D
Sbjct: 178 KIFVGNVPADMPSERLLAHFAAYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQASLVD 237

Query: 175 KVMAAGEHTINNK-KVDPKKAK 237
            V     H +  K  ++ KK K
Sbjct: 238 SVKVIDGHQLVCKLAIEGKKGK 259



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 34/66 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL  E + D +R  FS FG + E  +  DK+  + KG+ F+TF         LK P 
Sbjct: 79  FVRGLGWETNSDSLRAIFSAFGDLEEAVVITDKSTGRSKGYGFVTFRHADSAVLALKEPS 138

Query: 435 RTIGGK 452
           + I G+
Sbjct: 139 KKIDGR 144



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/73 (23%), Positives = 35/73 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG + +++  + +   F+ +G I E  + FDK   + +GF    +++ +     L    
Sbjct: 180 FVGNVPADMPSERLLAHFAAYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQASLVDSV 239

Query: 435 RTIGGKEVDVKRA 473
           + I G ++  K A
Sbjct: 240 KVIDGHQLVCKLA 252


>12_02_0450 +
           19172812-19172920,19173020-19173088,19173168-19173274,
           19173874-19174365
          Length = 258

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLS+ T ++ LRD F  YG++    +  D  TGRSRGF FI + + E     + A
Sbjct: 32  KLFVGGLSYGTDEQSLRDTFANYGQVIEAKIINDRETGRSRGFGFITYASSEEASAAITA 91



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVGGLS    +  +R+ F+ +G ++E ++  D+   + +GF FIT+  SE+    +    
Sbjct: 34  FVGGLSYGTDEQSLRDTFANYGQVIEAKIINDRETGRSRGFGFITYASSEEASAAITALD 93

Query: 432 KRTIGGKEVDVKRATPKPDG 491
            + + G+ + V  A  +  G
Sbjct: 94  GKDLDGRNIRVNTANERTGG 113


>12_02_1219 + 27096477-27096590,27096704-27097078
          Length = 162

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           + FVGGL+W T D+ L   F  +GEI    +  D  TGRSRGF F+ F + +++ D +  
Sbjct: 9   RCFVGGLAWATDDRSLEAAFSTFGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEG 68

Query: 187 AGEHTINNKKVDPKKAKAR 243
                ++ + +   +A++R
Sbjct: 69  MNGKELDGRNITVNEAQSR 87



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL+    D  +   FS FG ILE ++  D+   + +GF F+TF SEQ + D ++   
Sbjct: 11  FVGGLAWATDDRSLEAAFSTFGEILESKIINDRETGRSRGFGFVTFSSEQAMRDAIEGMN 70

Query: 435 -RTIGGKEVDVKRATPKPDGPG 497
            + + G+ + V  A  +  G G
Sbjct: 71  GKELDGRNITVNEAQSRRSGGG 92


>01_06_1799 +
           39948481-39948607,39948694-39948762,39948859-39948965,
           39949257-39949406
          Length = 150

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 26/60 (43%), Positives = 35/60 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLSW T D  L++ F ++G++    V  D  +GRSRGF F+ F   +     M A
Sbjct: 38  KLFVGGLSWNTNDDSLKEAFTSFGDVTEARVINDRESGRSRGFGFVSFANGDDAKSAMDA 97



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVGGLS   +DD ++  F+ FG + E  +  D+   + +GF F++F   +   + +    
Sbjct: 40  FVGGLSWNTNDDSLKEAFTSFGDVTEARVINDRESGRSRGFGFVSFANGDDAKSAMDAMD 99

Query: 432 KRTIGGKEVDVKRATPKPDG 491
            + + G+ + V  A  +P G
Sbjct: 100 GKELEGRSIRVNFANERPPG 119


>01_06_0833 + 32296957-32297256,32299257-32299895
          Length = 312

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 2/82 (2%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H K+FVGG+   T++ ELR HF  +G +  +    +  TG +RGFAF+ F  P+     +
Sbjct: 28  HGKVFVGGVPLGTSESELRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQFVNPDDAAAAI 87

Query: 184 AAG--EHTINNKKVDPKKAKAR 243
           AAG   + I    +D K A+ +
Sbjct: 88  AAGPDRNVIRGTTMDIKLAQLK 109



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 30/92 (32%), Positives = 47/92 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL    T+K+L+++F  +GE+    V  D NT   RGF FI F + ES  + +  
Sbjct: 125 KIFVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTARALKK 184

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
            +H +  + V+   A  +     S  S +  Q
Sbjct: 185 DKHFLCGQWVEVSLAMPKQQNAASGTSKLSVQ 216



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    ++ +++ +F++FG +    +  D      +GF FI F SE+     LK  K
Sbjct: 127 FVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTARALKKDK 186

Query: 435 RTIGGKEVDVKRATPK 482
             + G+ V+V  A PK
Sbjct: 187 HFLCGQWVEVSLAMPK 202



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVGG+    S+ E+R  FS FGT+  V  P +K     +GF F+ F   +     +   P
Sbjct: 32  FVGGVPLGTSESELRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQFVNPDDAAAAIAAGP 91

Query: 432 KR-TIGGKEVDVKRATPKPDGPG 497
            R  I G  +D+K A  KP   G
Sbjct: 92  DRNVIRGTTMDIKLAQLKPSAGG 114


>03_06_0587 - 34921535-34922041,34922579-34922689
          Length = 205

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 23/55 (41%), Positives = 35/55 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           + F+G LSW TTD+ L+D FG +G +    V  D  +GRSRGF F+ F   ++++
Sbjct: 8   RCFIGNLSWSTTDESLKDAFGKFGNLTEAKVVFDKYSGRSRGFGFVTFDEKKAME 62



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 25/82 (30%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+G LS   +D+ +++ F +FG + E ++ FDK   + +GF F+TF+ ++ + D ++   
Sbjct: 10  FIGNLSWSTTDESLKDAFGKFGNLTEAKVVFDKYSGRSRGFGFVTFDEKKAMEDAIEGMN 69

Query: 435 -RTIGGKEVDVKRATPKPDGPG 497
              + G+ + V +A  +P GPG
Sbjct: 70  GLDLDGRAITVDKA--QPQGPG 89


>03_01_0293 - 2258647-2258754,2258861-2259085
          Length = 110

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 28/80 (35%), Positives = 47/80 (58%), Gaps = 4/80 (5%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+   T D++LR HF  +G + S+++  D +TGR  GFAFI F   E +   +A 
Sbjct: 8   KMFVGGIGPYTGDEDLRRHFQLFGYVASVHMPIDRHTGRHHGFAFIQFTCLEHLINALAY 67

Query: 190 GE----HTINNKKVDPKKAK 237
                 HT+  + ++P+ ++
Sbjct: 68  RHTIHGHTLGTRLIEPRLSR 87



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           FVGG+     D+++R  F  FG +  V MP D+   +  GF FI F   E ++N L    
Sbjct: 10  FVGGIGPYTGDEDLRRHFQLFGYVASVHMPIDRHTGRHHGFAFIQFTCLEHLINAL--AY 67

Query: 432 KRTIGGKEVDVKRATPK 482
           + TI G  +  +   P+
Sbjct: 68  RHTIHGHTLGTRLIEPR 84


>01_01_1143 - 9064210-9065682
          Length = 490

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FV GL W+ T + L + F AYGEIE + V TD  TG+ +G+ FI+F         +  
Sbjct: 157 KIFVHGLGWDATAETLTEAFSAYGEIEDLRVVTDRATGKCKGYGFILFSRRSGARAALRE 216

Query: 190 GEHTINNK 213
            +  I N+
Sbjct: 217 PQKKIGNR 224



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  + ++I   ++  FFS++G I E  +  DK   + KGF    +++       L+ P 
Sbjct: 270 FVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTLDSAKKALQEPH 329

Query: 435 RTIGGKEVDVKRAT--PKPDGPG 497
           +   G  +  ++A   PKP+  G
Sbjct: 330 KQFEGVVLHCQKAIDGPKPNKGG 352



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           K+FV  +  +   ++L   F  YGEIE   +  D  TG+ +GFA  V+K  +S  K +
Sbjct: 268 KIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTLDSAKKAL 325


>04_04_1294 - 32424762-32426309
          Length = 515

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG + +++  D +  +FS+FG I E  + FDKT  + KGF    ++S +     L+ P 
Sbjct: 233 FVGNVHADVDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESARRALEEPT 292

Query: 435 RTIGGKEVDVKRA 473
           R   GK ++V++A
Sbjct: 293 RNFDGKMLNVQKA 305



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           KLFV GL W     +LR  F  +GE+E   V +D  +GRS+G+ F++F++  S
Sbjct: 115 KLFVHGLGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRS 167



 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 23/75 (30%), Positives = 40/75 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVG +  +     L ++F  +GEIE   +  D  TG+ +GFA  V+K+ ES  + +  
Sbjct: 231 KIFVGNVHADVDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESARRALEE 290

Query: 190 GEHTINNKKVDPKKA 234
                + K ++ +KA
Sbjct: 291 PTRNFDGKMLNVQKA 305



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL      D++R+ FS FG + +  +  DK   + KG+ F+ F S +     L+ P+
Sbjct: 117 FVHGLGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRSALRALRRPQ 176

Query: 435 RTIGGKEVDVKRATPKPDGP 494
             IGG+      A   P  P
Sbjct: 177 LQIGGRLAFCHLAASGPAPP 196


>03_02_0613 -
           9848514-9848539,9848942-9849200,9849326-9849365,
           9849952-9850117,9850228-9850756
          Length = 339

 Score = 56.0 bits (129), Expect = 2e-08
 Identities = 25/60 (41%), Positives = 36/60 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGGL+WET    LR+HF  +G+I    + +D  TGRS+G+ F+    P S  +   A
Sbjct: 34  KVFVGGLAWETHKDTLREHFERFGDILEAVIISDKLTGRSKGYGFVSSTTPRSHSRFRVA 93



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           Q Q+     G +T  + FVGGL+ E   D +R  F  FG ILE  +  DK   + KG+ F
Sbjct: 19  QVQQPAAAFGDTTLTKVFVGGLAWETHKDTLREHFERFGDILEAVIISDKLTGRSKGYGF 78

Query: 384 IT 389
           ++
Sbjct: 79  VS 80


>02_05_0506 +
           29613307-29613601,29613641-29613678,29613679-29613802,
           29614358-29614484,29614915-29615002,29615539-29615631,
           29616380-29616529
          Length = 304

 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           + K+FVGGL+WETT + LR  +  +GEI    V TD ++GRS+G+ F+
Sbjct: 36  YTKVFVGGLAWETTSERLRRFYDRFGEILEAVVITDRHSGRSKGYGFV 83



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +3

Query: 231 G*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           G +T  + FVGGL+ E + + +R F+  FG ILE  +  D+   + KG+ F++
Sbjct: 32  GDTTYTKVFVGGLAWETTSERLRRFYDRFGEILEAVVITDRHSGRSKGYGFVS 84


>07_03_1175 -
           24555965-24556117,24557809-24558264,24558270-24558436,
           24558468-24558756,24559620-24559726,24559841-24559909,
           24560001-24560109
          Length = 449

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 24/60 (40%), Positives = 36/60 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVGGLS+ T D  L+D F  YG++    +  D +TG+S+G+ FI + + E     + A
Sbjct: 32  KLFVGGLSYATDDTTLKDVFSHYGDVLEARIIIDRDTGKSKGYGFITYTSSEEAAAAVTA 91



 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVGGLS    D  +++ FS +G +LE  +  D+   + KG+ FIT+  SE+    +    
Sbjct: 34  FVGGLSYATDDTTLKDVFSHYGDVLEARIIIDRDTGKSKGYGFITYTSSEEAAAAVTAMD 93

Query: 432 KRTIGGKEVDVKRATPKPDG 491
            + + G+ V V  A  +  G
Sbjct: 94  GKDLQGRIVRVSTANDRAGG 113


>03_02_0472 -
           8737955-8738580,8738704-8738767,8739090-8739239,
           8739311-8739422,8739686-8739708
          Length = 324

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAA 189
           L+V GLS   TD++L  HF A GE+   ++  DP T  SRGF F+     +  D  +   
Sbjct: 22  LYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEADLCIKYL 81

Query: 190 GEHTINNKKVDPKKAKARHGK 252
               +  + +  +KAK R G+
Sbjct: 82  DRSVLEGRVITVEKAKRRRGR 102



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V GLS+ ++D ++   FS  G +++  +  D    + +GF F+T  + +  +  +K   
Sbjct: 23  YVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEADLCIKYLD 82

Query: 435 RTI-GGKEVDVKRA 473
           R++  G+ + V++A
Sbjct: 83  RSVLEGRVITVEKA 96


>04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890
          Length = 113

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/57 (40%), Positives = 35/57 (61%)
 Frame = +3

Query: 243 TWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN 413
           T+  F+GGLS   ++D +   FS++G +LE  +  DK  N+ KGF F+ F SE+  N
Sbjct: 36  TYRLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAAN 92



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           +LF+GGLS   T+  L + F  YG++    + TD  T R +GF F+ F + E+ +K
Sbjct: 38  RLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAANK 93


>02_05_1206 +
           34941293-34941562,34942052-34942153,34942249-34942521,
           34942863-34942913
          Length = 231

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/60 (38%), Positives = 34/60 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG LSW  T + L + F   G +    V  D  TGRSRG+ F+ +   E +D+ +++
Sbjct: 152 KLFVGNLSWTVTSEMLTEMFQKCGNVVGARVLYDGETGRSRGYGFVCYSTKEEMDEALSS 211



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/58 (34%), Positives = 28/58 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           KL+ G L +     +L      Y   E + V  D  TGRSRGFAF+     E  ++V+
Sbjct: 61  KLYFGNLPYNCDSAQLAGIVQDYATPEMVEVLYDRATGRSRGFAFVTMSTIEDCEQVI 118



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 2/82 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           + G L       ++     ++ T   VE+ +D+   + +GF F+T  + +    ++K   
Sbjct: 63  YFGNLPYNCDSAQLAGIVQDYATPEMVEVLYDRATGRSRGFAFVTMSTIEDCEQVIKNLD 122

Query: 435 RTI-GGKEVDVKRA-TPKPDGP 494
            ++  G+ + V  A  PKP  P
Sbjct: 123 GSLYSGRTMRVNFADKPKPKLP 144


>01_07_0160 -
           41563109-41563468,41563566-41563985,41564082-41564263,
           41564362-41564542,41565066-41565084,41565185-41565445,
           41566140-41566253,41566264-41566331,41566890-41567018,
           41567141-41567245,41567317-41567456,41567519-41567687,
           41567824-41567900,41568133-41568187,41568660-41568705,
           41568806-41568894,41568996-41569061,41569360-41569425,
           41569817-41569906,41570009-41570026
          Length = 884

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/75 (30%), Positives = 43/75 (57%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL V G+ W+   + LR++ G +G ++   V  + ++GRSRGF ++ F + +    V+  
Sbjct: 4   KLVVLGIPWDVDTEGLREYMGKFGPLDDCVVMKERSSGRSRGFGYVTFSSADDAKNVLEC 63

Query: 190 GEHTINNKKVDPKKA 234
            EH + N+ ++ K A
Sbjct: 64  -EHVLGNRTLEVKIA 77



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 26/75 (34%), Positives = 42/75 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L  E + +++R++F +FG I++  +P D  ++  +GF F+TF  E V  D +    
Sbjct: 242 FVGRLPQEANTEDLRHYFGKFGRIVDAYIPKDPKRSGHRGFGFVTFADEGVA-DRVARRS 300

Query: 435 RTIGGKEVDVKRATP 479
             I G EV +  A P
Sbjct: 301 HEILGHEVAIDTAAP 315



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/72 (34%), Positives = 37/72 (51%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++K+FVG L  E   ++LR +FG +G I    +  DP     RGF F+ F A E +   +
Sbjct: 238 NKKIFVGRLPQEANTEDLRHYFGKFGRIVDAYIPKDPKRSGHRGFGFVTF-ADEGVADRV 296

Query: 184 AAGEHTINNKKV 219
           A   H I   +V
Sbjct: 297 ARRSHEILGHEV 308



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/93 (26%), Positives = 43/93 (46%)
 Frame = +3

Query: 210 QESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           +E    +G       FV  +   + +   R  F  +G I ++ MP +      +G  FIT
Sbjct: 80  KEEMKSQGSKKATRIFVARIPQSVDESMFRRHFEAYGEITDLYMPKEHGSKGHRGIGFIT 139

Query: 390 FESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
           F+S + V+ +++     + G  V V RATPK +
Sbjct: 140 FQSAESVDSIMQ-DSHELDGTTVVVDRATPKDE 171



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 25/92 (27%), Positives = 43/92 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FV  +     +   R HF AYGEI  + +  +  +   RG  FI F++ ES+D +M  
Sbjct: 93  RIFVARIPQSVDESMFRRHFEAYGEITDLYMPKEHGSKGHRGIGFITFQSAESVDSIM-Q 151

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQ 285
             H ++   V   +A  +  ++    S   SQ
Sbjct: 152 DSHELDGTTVVVDRATPKDEEVRYPPSRGASQ 183



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 17/75 (22%), Positives = 43/75 (57%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           G+  ++  + +R +  +FG + +  +  +++  + +GF ++TF S     ++L+  +  +
Sbjct: 9   GIPWDVDTEGLREYMGKFGPLDDCVVMKERSSGRSRGFGYVTFSSADDAKNVLEC-EHVL 67

Query: 444 GGKEVDVKRATPKPD 488
           G + ++VK ATPK +
Sbjct: 68  GNRTLEVKIATPKEE 82


>09_06_0308 -
           22199389-22199451,22199604-22199924,22200178-22200423,
           22202152-22203337,22203487-22203551,22204205-22204486,
           22205005-22205106,22205587-22206105
          Length = 927

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 22/60 (36%), Positives = 32/60 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +++VG L W+  D  L   F  +G++    V  D  TGRSRGF F+     E +D  +AA
Sbjct: 238 RIYVGNLPWQVDDSRLVQLFSEHGKVVDARVVYDRETGRSRGFGFVTMATQEELDDAIAA 297



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +1

Query: 13   LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
            ++VG L W+     L   FG +G +    V  D  TGRSRGF F+        D V+A+
Sbjct: 845  IYVGNLRWDVDRLRLLKFFGEHGRVLVAQVVCDRQTGRSRGFGFVSMATLREPDDVIAS 903



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           RP      ++  +VG L  ++ D  +   FSE G +++  + +D+   + +GF F+T  +
Sbjct: 228 RPPRQFGPSFRIYVGNLPWQVDDSRLVQLFSEHGKVVDARVVYDRETGRSRGFGFVTMAT 287

Query: 399 EQVVNDLL 422
           ++ ++D +
Sbjct: 288 QEELDDAI 295



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMA 186
           K++VG L ++   + L   F   G +E   V  +  T RSRGF F+     E  +K V  
Sbjct: 144 KVYVGNLPYDIDSERLAQLFEQAGIVEVSEVIYNRETDRSRGFGFVTMSTVEEAEKAVEM 203

Query: 187 AGEHTINNKKVDPKKAKARHGKI 255
              + ++ + +   KA  R  ++
Sbjct: 204 FHRYDVDGRLLTVNKAAPRGARV 226



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 16/77 (20%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L  +I  + +   F + G +   E+ +++  ++ +GF F+T  + +     ++   
Sbjct: 146 YVGNLPYDIDSERLAQLFEQAGIVEVSEVIYNRETDRSRGFGFVTMSTVEEAEKAVEMFH 205

Query: 435 R-TIGGKEVDVKRATPK 482
           R  + G+ + V +A P+
Sbjct: 206 RYDVDGRLLTVNKAAPR 222



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 13/56 (23%), Positives = 30/56 (53%)
 Frame = +3

Query: 255  FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
            +VG L  ++    +  FF E G +L  ++  D+   + +GF F++  + +  +D++
Sbjct: 846  YVGNLRWDVDRLRLLKFFGEHGRVLVAQVVCDRQTGRSRGFGFVSMATLREPDDVI 901


>08_02_1559 -
           27873345-27873407,27873549-27873830,27874162-27874263,
           27874402-27874872
          Length = 305

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           + +VG L W+  D  L   F  +GE+ + +V  D  +GRSRGF F+   + E +D  ++A
Sbjct: 222 RAYVGNLPWQVDDSRLLQLFSEHGEVVNASVVYDRESGRSRGFGFVSMASKEELDDAISA 281



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 1/90 (1%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           RP    +  +  +VG L  ++ D  +   FSE G ++   + +D+   + +GF F++  S
Sbjct: 212 RPPRQFAPAFRAYVGNLPWQVDDSRLLQLFSEHGEVVNASVVYDRESGRSRGFGFVSMAS 271

Query: 399 EQVVNDLLKT-PKRTIGGKEVDVKRATPKP 485
           ++ ++D +     + + G+ + V  A  +P
Sbjct: 272 KEELDDAISALDGQELDGRPLRVNVAAERP 301



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMA 186
           K++VG L ++   + L   F   G +E   V  +  TG+SRGF F+     E  DK +  
Sbjct: 128 KVYVGNLPYDVDSEGLAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADKAIEM 187

Query: 187 AGEHTINNKKVDPKKAKARHGKI 255
              + IN + ++  +A  R  ++
Sbjct: 188 LNRYDINGRLLNVNRAAPRGSRV 210



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L  ++  + +   F + G +   E+ +++   Q +GF F+T  + +  +  ++   
Sbjct: 130 YVGNLPYDVDSEGLAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADKAIEMLN 189

Query: 435 R-TIGGKEVDVKRATPK 482
           R  I G+ ++V RA P+
Sbjct: 190 RYDINGRLLNVNRAAPR 206


>07_03_1378 +
           26158233-26158562,26159075-26159176,26159551-26159850,
           26160006-26160068
          Length = 264

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 23/78 (29%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L+  + +  + N FSE GT+L+ ++ +D+   + +GF F+T+ S + VN+ +    
Sbjct: 183 YVGNLAWGVDNSTLENLFSEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAISNLD 242

Query: 435 RT-IGGKEVDVKRATPKP 485
              + G+++ V  A  KP
Sbjct: 243 GVDLDGRQIRVTVAESKP 260



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           KL+VG L+W   +  L + F   G +    V  D  +GRSRGF F+ + + E ++  ++
Sbjct: 181 KLYVGNLAWGVDNSTLENLFSEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAIS 239



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 26/52 (50%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           K+FVG L +     +L   F   G +E + V  D  TGRSRGF F+     E
Sbjct: 81  KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSTAE 132



 Score = 35.9 bits (79), Expect = 0.027
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           FVG L   +   ++   F + G++  VE+ +D+   + +GF F+T   +E+    + +  
Sbjct: 83  FVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSTAEEAGAAVEQFN 142

Query: 432 KRTIGGKEVDVKRATPKP 485
             T  G+ + V    P P
Sbjct: 143 GYTFQGRPLRVNSGPPPP 160


>03_06_0523 +
           34499533-34499705,34499808-34499917,34500037-34500224,
           34500984-34501451
          Length = 312

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +FVGG+ ++ T+ +L   F  YGE+  +N+  D  TG+S+GFAF+ ++   S
Sbjct: 38  VFVGGIPYDLTEGDLLAVFAQYGEVVDVNLVRDKGTGKSKGFAFLAYEDQRS 89



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 14/50 (28%), Positives = 33/50 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVGG+  ++++ ++   F+++G +++V +  DK   + KGF F+ +E ++
Sbjct: 39  FVGGIPYDLTEGDLLAVFAQYGEVVDVNLVRDKGTGKSKGFAFLAYEDQR 88


>03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800
          Length = 252

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 24/78 (30%), Positives = 41/78 (52%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 195
           +VG L W+ T+ +LRD F +  +I SI    +  TG SRGF  + F+  ES++K +   +
Sbjct: 176 YVGNLKWDVTETDLRDFFKSL-KISSIRFAINKRTGDSRGFCHVDFEDDESLEKAVGMNQ 234

Query: 196 HTINNKKVDPKKAKARHG 249
             +  + +    A +  G
Sbjct: 235 SELRGRPIKISYAVSNRG 252



 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 22/80 (27%), Positives = 43/80 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+   GL + TT+ E+R+ F  +G + S+ +   P++G  RG AF+ F++ E + K +  
Sbjct: 74  KVVASGLPYTTTEAEIRELFERFGPLRSLQLSRFPDSGNFRGLAFVSFESNEVVMKSLEL 133

Query: 190 GEHTINNKKVDPKKAKARHG 249
               I N+ +  ++ +   G
Sbjct: 134 DGFKIGNRFMRVERCRLAAG 153



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +3

Query: 213 ESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           E   + G   T +    GL    ++ EIR  F  FG +  +++         +G  F++F
Sbjct: 62  EEEEEAGIYETGKVVASGLPYTTTEAEIRELFERFGPLRSLQLSRFPDSGNFRGLAFVSF 121

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDVKR 470
           ES +VV   L+     IG + + V+R
Sbjct: 122 ESNEVVMKSLELDGFKIGNRFMRVER 147



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 15/73 (20%), Positives = 36/73 (49%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L  ++++ ++R+FF     I  +    +K     +GFC + FE ++ +   +   +
Sbjct: 176 YVGNLKWDVTETDLRDFFKSL-KISSIRFAINKRTGDSRGFCHVDFEDDESLEKAVGMNQ 234

Query: 435 RTIGGKEVDVKRA 473
             + G+ + +  A
Sbjct: 235 SELRGRPIKISYA 247


>06_03_1455 +
           30264023-30264174,30265930-30266070,30266328-30266430,
           30266510-30266659,30267184-30267229,30267383-30267738
          Length = 315

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAA 189
           L+V GLS   T++EL+D+F   G + S +V  +P+T  SRGFAF+     E  ++ +   
Sbjct: 109 LYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVEDAERCIKYL 168

Query: 190 GEHTINNKKVDPKKAK 237
            +  +  + +  +K++
Sbjct: 169 NQSVMEGRNITVEKSR 184



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/86 (23%), Positives = 46/86 (53%), Gaps = 4/86 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V GLSS +++ E++++FS+ G +    +  +      +GF F+T ++ +     +K   
Sbjct: 110 YVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVEDAERCIKYLN 169

Query: 435 RTI-GGKEVDV---KRATPKPDGPGA 500
           +++  G+ + V   +R  P+   PG+
Sbjct: 170 QSVMEGRNITVEKSRRGRPRTPTPGS 195


>05_03_0022 + 7452234-7452389,7452955-7453113
          Length = 104

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DK 177
           +  +++VG L +   ++ L+D F  YG + S  +  D  TGRSRGF F+ F+  +S  D 
Sbjct: 21  QESRVYVGNLPYRADERSLKDSFSNYGAVSS-EIAVDRETGRSRGFGFVSFQDSKSASDA 79

Query: 178 VMAAGEHTINNKKVDPKKAKAR 243
           +       I  + V  ++A+ R
Sbjct: 80  IKGMNGQDIGGRNVIVQEAQPR 101


>11_02_0073 -
           8020401-8020512,8020594-8020679,8020761-8020921,
           8021196-8021400,8021664-8021697,8022352-8022422,
           8023363-8023542,8023625-8023765,8023859-8023975,
           8024074-8024469
          Length = 500

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 20/58 (34%), Positives = 38/58 (65%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++F+GGL  +TT+++LR+   ++GEI  + +  D  T  ++GFAF+ F A E+  + +
Sbjct: 105 EVFIGGLPRDTTEEDLRELCDSFGEIYEVRLMKDKETKENKGFAFVNFTAKEAAQRAI 162



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           E F+GGL  + +++++R     FG I EV +  DK   + KGF F+ F +++
Sbjct: 105 EVFIGGLPRDTTEEDLRELCDSFGEIYEVRLMKDKETKENKGFAFVNFTAKE 156


>10_05_0029 -
           8319233-8319408,8319516-8319584,8319754-8319838,
           8320112-8320225
          Length = 147

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 20/48 (41%), Positives = 30/48 (62%)
 Frame = +1

Query: 22  GGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           GG+S+ T D+ L++ F  YGE+    V  D  TGRSRGF F+ + + +
Sbjct: 66  GGISYGTDDQSLKEAFANYGEVIEARVIVDRTTGRSRGFGFVTYTSTD 113



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +3

Query: 261 GGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           GG+S    D  ++  F+ +G ++E  +  D+T  + +GF F+T+ S
Sbjct: 66  GGISYGTDDQSLKEAFANYGEVIEARVIVDRTTGRSRGFGFVTYTS 111


>07_01_0286 + 2086630-2086856,2087052-2087067
          Length = 80

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 23/45 (51%), Positives = 30/45 (66%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAF 144
           +L VGG+S +  D ELRDHFG YG++  I ++ D  TG  R FAF
Sbjct: 8   RLSVGGVSPDMGDTELRDHFGRYGDVADIWLRRDRLTGLPRRFAF 52



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           VGG+S ++ D E+R+ F  +G + ++ +  D+     + F F
Sbjct: 11  VGGVSPDMGDTELRDHFGRYGDVADIWLRRDRLTGLPRRFAF 52


>03_02_0558 - 9459745-9459980,9460089-9460157,9460630-9460846
          Length = 173

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 22/55 (40%), Positives = 35/55 (63%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           KLF+ GLS  TTD++L++ F  +G++    V TD  +GRS+GF F+ +   E  +
Sbjct: 68  KLFISGLSRLTTDEKLKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAE 122



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           F+ GLS   +D++++N F+ FG +LE ++  D+   + KGF F+ + + E+  N   +  
Sbjct: 70  FISGLSRLTTDEKLKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAENARQEMN 129

Query: 432 KRTIGGKEVDVKRATPKPDGP 494
            + + G  + V  A P+   P
Sbjct: 130 AKFLDGWVIFVDPAKPRQQKP 150


>05_03_0025 + 7462272-7462412,7462865-7463032
          Length = 102

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMA 186
           +++VG L +   D+ L+D F  YG I S  +  D   GRSRGF F+ F+  ES++  +  
Sbjct: 19  RVYVGNLPFSANDRSLKDSFANYGAI-SAEIAWDSVMGRSRGFGFVNFEDSESVNAAIQG 77

Query: 187 AGEHTINNKKVDPKKAKAR 243
                I  + V   +A  R
Sbjct: 78  MNGQDIGGRNVTVAQANTR 96


>03_06_0728 +
           35768830-35769324,35769404-35769462,35770440-35770509,
           35770626-35770748,35770836-35770964,35771268-35771717
          Length = 441

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 4/84 (4%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHF----GAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           R   +FVG L ++  D+E+   F    G+ G++E+I V  DP+T   +G A+++FK  E+
Sbjct: 235 RKRTVFVGNLPFDIKDEEVYQKFCGSSGSEGDVEAIRVVRDPDTSLGKGIAYVLFKTREA 294

Query: 169 IDKVMAAGEHTINNKKVDPKKAKA 240
            + V+   +  I ++ +    AK+
Sbjct: 295 ANTVVRKQDFKIRDRLLRLAHAKS 318



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDP--NTGRSRGFAFIVFKAPESIDKVMA 186
           +FVG L  +T  K L   F A+GEIES+ +++ P  +T   R  A I  K  +S+D V A
Sbjct: 129 VFVGNLPLKTKRKALTKEFAAFGEIESVRIRSVPLTDTKIPRKGAVIKGKINDSVDNVHA 188


>01_04_0003 -
           14989160-14989445,14989673-14989807,14991418-14991508,
           14991571-14991712,14991924-14992403,14992610-14993548
          Length = 690

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 25  GLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT- 201
           G S+ TT+++L   F  YG + S  V  D  +G SRGF F+  +  E  D  + A + T 
Sbjct: 521 GFSYATTERDLEKKFSKYGRVTSARVVRDKRSGDSRGFGFLSLEKDEDADAAIRACDETE 580

Query: 202 INNKKVDPKKAKA 240
            N + +  +K+KA
Sbjct: 581 WNGRIILVEKSKA 593


>10_08_0254 +
           16236689-16236793,16237760-16237808,16237988-16238076,
           16238178-16238234,16238684-16238746,16238828-16238893,
           16239520-16239606,16239691-16239784,16240351-16240673,
           16241022-16241048,16241065-16241145,16241445-16241476,
           16242126-16242266,16242455-16242516,16243170-16243387
          Length = 497

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           LF+G L  +  +K L D F A+G I  +  +  DP TG SRGF F+ + + ES D+ + A
Sbjct: 114 LFIGNLDPDVDEKLLYDTFSAFGVIVTNPKIMRDPETGNSRGFGFVSYDSFESSDQAIEA 173

Query: 190 --GEHTIN 207
              +H  N
Sbjct: 174 MNNQHLCN 181



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTIL-EVEMPFDKTKNQRKGFCFITFES 398
           F+G L  ++ +  + + FS FG I+   ++  D      +GF F++++S
Sbjct: 115 FIGNLDPDVDEKLLYDTFSAFGVIVTNPKIMRDPETGNSRGFGFVSYDS 163


>04_04_0674 +
           27173948-27174188,27174704-27175260,27175310-27175399,
           27175475-27175714,27175801-27176022,27176124-27176433,
           27176528-27176847,27176906-27177021,27177133-27177227,
           27177331-27177407,27177520-27177615
          Length = 787

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 20/59 (33%), Positives = 36/59 (61%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++FVGGL  + T+ +LR  FG  GEI  + +  +P T +++GFAF+ +   E   + ++
Sbjct: 191 EVFVGGLDKDATESDLRKVFGEVGEITEVRLMMNPVTKKNKGFAFLRYATVEQARRAVS 249



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +3

Query: 198 HHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGF 377
           HH+  +   K      +E FVGGL  + ++ ++R  F E G I EV +  +    + KGF
Sbjct: 177 HHEMVKEHRKR---KEFEVFVGGLDKDATESDLRKVFGEVGEITEVRLMMNPVTKKNKGF 233

Query: 378 CFITFES-EQVVNDLLKTPKRTIGGK 452
            F+ + + EQ    + +    ++G K
Sbjct: 234 AFLRYATVEQARRAVSELKNPSVGLK 259



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESIN----VKTDPNTGRSRGFAFIVFKA-PES 168
           ++ LFVG +    T + L++   +YG +E+ +    V+   N G +RG+A + F   PE+
Sbjct: 280 NDTLFVGNICKTWTKEHLKEKLKSYG-VENFDDLLLVEDSNNPGMNRGYALLEFSTRPEA 338

Query: 169 ID 174
           +D
Sbjct: 339 MD 340



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/77 (20%), Positives = 36/77 (46%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+ GL     +  ++ +   YG IE + +  +    + + F F+ F   ++ D  +A  
Sbjct: 380 VFIDGLPPSWDEDRVKKYLKKYGAIEKVELARNMPAAKRKDFGFVTF---DTHDNAVACA 436

Query: 193 EHTINNKKVDPKKAKAR 243
           +  I N ++    +KA+
Sbjct: 437 D-GITNSEIGEGDSKAK 452


>09_02_0211 -
           5817564-5817578,5817711-5818040,5818095-5818196,
           5818616-5818915
          Length = 248

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++VG L+   T + L++ F   GE+ S  V   P T +S+G+ F+ F + E +   ++ 
Sbjct: 181 KVYVGNLAKSVTTEMLKNFFSEKGEVLSATVSRIPGTAKSKGYGFVTFSSEEEVQAAVST 240

Query: 190 GEHTINNK 213
             +  N K
Sbjct: 241 FNNADNQK 248



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL+VG +    T+ EL   F  +G +E   V  D  TGRSR F F+    PE  +  + +
Sbjct: 71  KLYVGNIPRTVTNDELAAMFADHGTVERAEVMFDKYTGRSRRFGFVTMSTPEEANAAIES 130

Query: 190 GEHT 201
              T
Sbjct: 131 LNET 134



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           +VG L+  ++ + ++NFFSE G +L   +       + KG+ F+TF SE+ V   + T
Sbjct: 183 YVGNLAKSVTTEMLKNFFSEKGEVLSATVSRIPGTAKSKGYGFVTFSSEEEVQAAVST 240



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/62 (25%), Positives = 34/62 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +   +++DE+   F++ GT+   E+ FDK   + + F F+T  + +  N  +++  
Sbjct: 73  YVGNIPRTVTNDELAAMFADHGTVERAEVMFDKYTGRSRRFGFVTMSTPEEANAAIESLN 132

Query: 435 RT 440
            T
Sbjct: 133 ET 134


>08_01_0118 +
           947394-947885,948709-948810,948914-949219,949557-949616
          Length = 319

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 18/58 (31%), Positives = 33/58 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           K++VG ++W    +ELR++F   G + S  + TD   GR R + F+ F + E ++  +
Sbjct: 238 KIYVGNIAWSVEPQELREYFSQCGTVVSTRLLTDRKGGRGRVYGFLSFASAEELEAAL 295



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 17/73 (23%), Positives = 39/73 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG ++  +   E+R +FS+ GT++   +  D+   + + + F++F S + +   LK   
Sbjct: 240 YVGNIAWSVEPQELREYFSQCGTVVSTRLLTDRKGGRGRVYGFLSFASAEELEAALKLDN 299

Query: 435 RTIGGKEVDVKRA 473
               G+ + V++A
Sbjct: 300 THFHGRNILVRQA 312



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA-PES 168
           R  +LFV  L       +L + F  YG + S+ +  DP TG SRG  F+  ++ PE+
Sbjct: 132 RPRELFVCNLPRRCDVDDLYELFKPYGTVLSVEISRDPETGLSRGCGFVTMRSLPEA 188



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           E FV  L      D++   F  +GT+L VE+  D      +G  F+T  S
Sbjct: 135 ELFVCNLPRRCDVDDLYELFKPYGTVLSVEISRDPETGLSRGCGFVTMRS 184


>03_06_0337 +
           33224333-33224479,33224603-33224663,33224740-33224776,
           33225237-33225367,33225447-33225590,33225686-33225776,
           33225973-33226106,33226234-33226373,33227328-33227426,
           33227520-33227602,33227690-33227744,33227826-33227937,
           33228274-33228766,33228881-33229094,33229203-33229273,
           33229733-33229901,33229991-33230120,33230556-33230968,
           33231059-33231262
          Length = 975

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 26/96 (27%), Positives = 50/96 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+  L ++ +++E+ + F A+G++ES        T R RG  F+ F  PE+ D  ++A 
Sbjct: 540 LFISNLPFDLSNEEVTERFSAFGKVESFFPVLHKLTKRPRGTGFLKFSTPEAADAAVSAA 599

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
            +      +  K    +  K L ++SA K ++ K++
Sbjct: 600 -NAAPGLGIFIKSRALKIMKALDKESAHKKELEKAK 634



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  ++ V  L ++ T KE+ D F   G I  +++    + G S+GFAF+ F   +  +  
Sbjct: 316 RKWRVIVRNLPFKITVKEIMDIFSLAGFIWDVSIPQKSDDGASKGFAFVSFTRKQDAENA 375

Query: 181 M 183
           +
Sbjct: 376 I 376



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ-VVNDLLKTP 431
           FV  L       ++   FSE G +    M   K     +GF F+ F + Q     + +  
Sbjct: 37  FVSNLPYTFKSSDLEAVFSEVGPVRRCFMVAPKGSETSRGFGFVQFATVQDAERSIQQKD 96

Query: 432 KRTIGGKEVDVKRAT 476
             ++ G+++ VK AT
Sbjct: 97  GFSVAGRKIRVKLAT 111


>10_01_0298 -
           3094197-3094307,3095093-3095253,3095462-3095666,
           3096349-3096534,3096616-3096756,3096843-3096959,
           3097046-3097456
          Length = 443

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++F+GGL  +TT+ +L +   A+GEI  + +  D  T  ++GFAF+ F   +   + +
Sbjct: 110 EVFIGGLPRDTTEDDLHELCEAFGEISEVRLMKDKETKENKGFAFVTFTGKDGAQRAI 167



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 19/48 (39%), Positives = 28/48 (58%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           E F+GGL  + ++D++      FG I EV +  DK   + KGF F+TF
Sbjct: 110 EVFIGGLPRDTTEDDLHELCEAFGEISEVRLMKDKETKENKGFAFVTF 157



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 5/81 (6%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGT-ILEVEMPFD-KTKNQRKGFCFITFESE---QVVNDL 419
           FVG +   +S+DE+RN     G  ++ +EM  D    ++ +GF F+ + +          
Sbjct: 192 FVGNVPKGLSEDELRNIIQGKGPGVVNIEMFKDLHDPSRNRGFLFVEYYNHACADYAKQK 251

Query: 420 LKTPKRTIGGKEVDVKRATPK 482
           L  P   + G ++ V  A PK
Sbjct: 252 LSAPNFKVDGSQLTVSWAEPK 272


>05_03_0023 + 7457836-7457976,7458313-7458480
          Length = 102

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMA 186
           +++VG L +   ++ L D+F  YG I S  +  D   GR RGF F+ F+  ES++  +  
Sbjct: 19  RVYVGNLPYSVDEQTLMDYFADYGAI-SAEIAWDSEMGRPRGFGFVNFEDNESVNAAIHG 77

Query: 187 AGEHTINNKKVDPKKAKAR 243
                I  +KV   +A+ R
Sbjct: 78  MNGQDIGGRKVTVARAQMR 96


>04_04_0435 -
           25170348-25170593,25170989-25171189,25171580-25171756,
           25172284-25172418,25173131-25173262,25173292-25173369,
           25173452-25174108,25174210-25174328,25175897-25176173
          Length = 673

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 30/77 (38%), Positives = 43/77 (55%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +   +FV  LS  TT ++L   FGAYG I S  +    + G+SR F FI FK+P+  D  
Sbjct: 216 KFNNVFVKNLSESTTKEDLVKIFGAYGNITSAVIMVGMD-GKSRCFGFINFKSPD--DAA 272

Query: 181 MAAGEHTINNKKVDPKK 231
            A  E  +N KK++ K+
Sbjct: 273 RAVEE--LNGKKINDKE 287



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           + L+VG L    TD +L + F   G++ S+ V  D ++ RS G+A++ F  P
Sbjct: 39  QSLYVGDLEASVTDSQLYELFSQAGQVMSVRVCRDISSRRSLGYAYVNFNNP 90



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 11/48 (22%), Positives = 27/48 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           +VG L + ++D ++   FS+ G ++ V +  D +  +  G+ ++ F +
Sbjct: 42  YVGDLEASVTDSQLYELFSQAGQVMSVRVCRDISSRRSLGYAYVNFNN 89


>03_03_0130 -
           14699658-14699723,14699828-14700109,14700444-14700545,
           14701038-14701385
          Length = 265

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           +VG LS  + +  + N FS  G +LE ++ +D+   + +GF F+T+ S E+V N +    
Sbjct: 183 YVGNLSWGVDNAALANLFSGEGEVLEAKVIYDRESGRSRGFGFVTYGSAEEVENAVSNLD 242

Query: 432 KRTIGGKEVDVKRATPKP 485
              + G+++ V  A  KP
Sbjct: 243 GADMDGRQIRVTVAESKP 260



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++VG LSW   +  L + F   GE+    V  D  +GRSRGF F+ + + E ++  ++
Sbjct: 181 RVYVGNLSWGVDNAALANLFSGEGEVLEAKVIYDRESGRSRGFGFVTYGSAEEVENAVS 239



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVG L +     +L   F   G +E + V  D  TGRSRGF F+      S+++V AA
Sbjct: 87  RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTM---SSVEEVEAA 143

Query: 190 GEHTINNKKVDPKKAKARHG 249
            E   N   +D +  +   G
Sbjct: 144 VEQ-FNGYILDGRSLRVNSG 162



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF 383
           +++E    E  S     FVG L   +   ++   F + G++  VE+ +DK   + +GF F
Sbjct: 72  EEEEGSGGEEFSDDLRVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGF 131

Query: 384 ITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKP 485
           +T  S E+V   + +     + G+ + V    P P
Sbjct: 132 VTMSSVEEVEAAVEQFNGYILDGRSLRVNSGPPPP 166


>02_05_0810 -
           31934965-31935013,31935096-31935217,31935328-31935519,
           31937689-31937759,31938708-31938819,31938911-31939015
          Length = 216

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/75 (28%), Positives = 43/75 (57%), Gaps = 2/75 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  T +E++ HF A G +  + + TD   G+ +GFA++ F   E++ + +   
Sbjct: 92  VYVGNVDYACTPEEVQQHFQACGTVNRVTILTD-KFGQPKGFAYVEFLEQEAVQEALNLN 150

Query: 193 EHTINNK--KVDPKK 231
           E  ++ +  KV PK+
Sbjct: 151 ESELHGRQIKVAPKR 165



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/81 (25%), Positives = 41/81 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    + +E++  F   GT+  V +  DK   Q KGF ++ F  ++ V + L   +
Sbjct: 93  YVGNVDYACTPEEVQQHFQACGTVNRVTILTDKF-GQPKGFAYVEFLEQEAVQEALNLNE 151

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
             + G+++ V  A  + + PG
Sbjct: 152 SELHGRQIKV--APKRTNVPG 170


>07_01_0577 -
           4286048-4286186,4286600-4286660,4286957-4287089,
           4287286-4287350,4288346-4288451,4288529-4288750,
           4289619-4289852,4289948-4290037,4290605-4291507
          Length = 650

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 243 TWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           T E FVGGL  +  +D++R  F++ G I EV M  +    + KG+CF+ +
Sbjct: 235 TMEVFVGGLHRDAKEDDVRAVFAKAGEITEVRMIMNPLAGKNKGYCFVRY 284



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 16/59 (27%), Positives = 33/59 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++FVGGL  +  + ++R  F   GEI  + +  +P  G+++G+ F+ ++      K +A
Sbjct: 237 EVFVGGLHRDAKEDDVRAVFAKAGEITEVRMIMNPLAGKNKGYCFVRYRHAAQAKKAIA 295



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +FV G+       +L++ F  +G+IES+ +  D  + + R FAFI +   E+    + 
Sbjct: 411 KSIFVDGIPTSWDHAQLKEIFKKHGKIESVVLSRDMPSAKRRDFAFINYITREAAISCLE 470

Query: 187 A---GEHTINNKKVDPKKAKAR 243
           +    E + N  KV+ K + A+
Sbjct: 471 SFDKEEFSKNGSKVNIKVSLAK 492


>03_01_0525 +
           3952095-3952217,3953131-3953614,3953695-3953750,
           3953942-3954018,3954862-3954958,3955274-3955407,
           3955760-3955825,3955954-3956044
          Length = 375

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +FVG L+ + TD  L++ F  +Y  ++   V TDPNTGRS+G+ F+ F      ++ M
Sbjct: 111 IFVGDLAPDVTDYLLQETFRVSYPSVKGAKVVTDPNTGRSKGYGFVKFADENEKNRAM 168


>02_05_0627 +
           30463452-30463774,30463841-30463956,30464125-30464371,
           30464458-30464555,30465216-30465284,30465752-30465820,
           30465913-30466028
          Length = 345

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/54 (38%), Positives = 35/54 (64%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           ++LFV GLS+ T++K LR  F  +GE+  + +  D  + RS+G+AFI +   E+
Sbjct: 279 KRLFVTGLSFYTSEKTLRAAFEPFGELVEVKIIMDKISKRSKGYAFIEYTTEEA 332



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           FV GLS   S+  +R  F  FG ++EV++  DK   + KG+ FI + +E+     LK
Sbjct: 282 FVTGLSFYTSEKTLRAAFEPFGELVEVKIIMDKISKRSKGYAFIEYTTEEAGGAALK 338


>02_04_0518 + 23601355-23602498,23603481-23603779
          Length = 480

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 4/105 (3%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV  +       ELR  F  +GEIE+  +  D  TG+ RG+A   +K PE + K +  
Sbjct: 192 KLFVDNVPARAAHDELRRLFSRFGEIEAGPLGADRATGQFRGYAIFFYKYPEGLTKALEE 251

Query: 190 GEHTINNKKVDPKKA----KARHGKILSEDSAVKSQMMKSETSSV 312
            +   +  ++  ++A    K +H   +  D+  +S   ++  S +
Sbjct: 252 RKVVFDGCELHCRRAHRVNKEKHLMTMPADAGAQSNGFENAASPI 296



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           H +LFV GLS   T   +   F  +G ++  +   D  TGR RG+ F+ F+   +  + +
Sbjct: 103 HRRLFVHGLSPGVTAAAMAAAFAPFGALDECHAVADRATGRCRGYGFVTFRRRSAARRAL 162

Query: 184 AA 189
           AA
Sbjct: 163 AA 164



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  + +  + DE+R  FS FG I    +  D+   Q +G+    ++  + +   L+  K
Sbjct: 194 FVDNVPARAAHDELRRLFSRFGEIEAGPLGADRATGQFRGYAIFFYKYPEGLTKALEERK 253

Query: 435 RTIGGKEVDVKRA 473
               G E+  +RA
Sbjct: 254 VVFDGCELHCRRA 266



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL---K 425
           FV GLS  ++   +   F+ FG + E     D+   + +G+ F+TF         L    
Sbjct: 107 FVHGLSPGVTAAAMAAAFAPFGALDECHAVADRATGRCRGYGFVTFRRRSAARRALAADA 166

Query: 426 TPKRTIGGKEVDVKRATPKPDGP 494
           + +  +GG+ V  + A+  P  P
Sbjct: 167 SSRLAVGGRPVACQLASLGPTSP 189


>08_02_0526 +
           18184146-18184168,18184247-18184438,18184846-18184954,
           18185071-18185220,18185973-18186136,18186273-18186359,
           18187083-18187137,18187911-18188333
          Length = 400

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 20/45 (44%), Positives = 29/45 (64%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           L+V GLS   T+++L   F   G+++S +V  DP T  SRGFAF+
Sbjct: 85  LYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFV 129



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +V GLS+ ++++++  FFS+ G +    +  D    + +GF F+T +S       +K   
Sbjct: 86  YVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDSVDDARRCIKYLH 145

Query: 435 RTI-GGKEVDVKR 470
           RT+  G+ V V++
Sbjct: 146 RTVLEGRLVTVEK 158


>06_01_0815 +
           6166861-6166953,6167074-6167173,6168569-6168639,
           6169873-6170064,6170168-6170290
          Length = 192

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 2/75 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG + +  T +E++ HF + G +  + + TD   G+ +GFA++ F   E++ + +   
Sbjct: 84  VYVGNVDYACTPEEVQQHFNSCGTVNRVTILTD-KFGQPKGFAYVEFLEVEAVQEAVKLN 142

Query: 193 EHTINNK--KVDPKK 231
           E  ++ +  KV PK+
Sbjct: 143 ESELHGRQIKVAPKR 157



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/81 (25%), Positives = 42/81 (51%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG +    + +E++  F+  GT+  V +  DK   Q KGF ++ F   + V + +K  +
Sbjct: 85  YVGNVDYACTPEEVQQHFNSCGTVNRVTILTDKF-GQPKGFAYVEFLEVEAVQEAVKLNE 143

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
             + G+++ V  A  + + PG
Sbjct: 144 SELHGRQIKV--APKRTNVPG 162


>05_01_0112 -
           757514-758444,758525-758571,759074-759236,759861-760366
          Length = 548

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 23/78 (29%), Positives = 41/78 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L+ +I++D+++ FFS+   I  +    DK     KG+  + F     V   +K  +
Sbjct: 270 YVGNLAWDITEDDLKKFFSDC-KISSIRFGTDKETGDFKGYVHVDFSEGTSVAVAMKLDQ 328

Query: 435 RTIGGKEVDVKRATPKPD 488
           + I G+ V ++ A PK D
Sbjct: 329 KVIKGRPVRIRCAVPKKD 346



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + +++VG L+W+ T+ +L+  F    +I SI   TD  TG  +G+  + F    S+   M
Sbjct: 266 YNRVYVGNLAWDITEDDLKKFFSDC-KISSIRFGTDKETGDFKGYVHVDFSEGTSVAVAM 324

Query: 184 AAGEHTINNKKV 219
              +  I  + V
Sbjct: 325 KLDQKVIKGRPV 336



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 18/65 (27%), Positives = 32/65 (49%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGG+    S+D+IR+FF   G+I  V+        + +G   +TF+++      L    
Sbjct: 177 YVGGIPYYSSEDDIRSFFEACGSITSVDCMTFPESGKFRGIAILTFKTDAAAQRALALDG 236

Query: 435 RTIGG 449
             +GG
Sbjct: 237 ADMGG 241


>09_01_0079 -
           1159963-1160211,1160303-1160509,1160631-1160801,
           1161732-1161869,1162184-1162273,1162354-1162431,
           1162510-1163166,1163245-1163363,1164305-1164584
          Length = 662

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 27/77 (35%), Positives = 44/77 (57%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           +   ++V  LS  TT+ +L++ FG +G I S  V  + + GRS+ F F+ F++P+  D  
Sbjct: 217 KFNNVYVKNLSENTTEDDLKEIFGKFGTITSAVVMREGD-GRSKCFGFVNFESPD--DAA 273

Query: 181 MAAGEHTINNKKVDPKK 231
            A  E  +N KK D K+
Sbjct: 274 QAVQE--LNGKKFDDKE 288



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 35/116 (30%), Positives = 51/116 (43%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           ++  L++  L     D +LR+ F  YG I S  V  D N G SRG  F+ FK+ E   + 
Sbjct: 320 QNTNLYLKNLDDSVDDDKLRELFAEYGTITSCKVMRDSN-GVSRGSGFVAFKSAEDASRA 378

Query: 181 MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPL 348
           +A     +N+K V  K       +   ED   + Q   S+   V L  S   R P+
Sbjct: 379 LA----EMNSKMVGSKPLYVALAQ-RKEDRKARLQAQFSQLRPVPLAPSVGPRMPM 429



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+VG L     D +L D F   G + S+ V  D NT RS G+A++ + +P    + +   
Sbjct: 42  LYVGDLDVSVQDAQLFDVFAQVGGVVSVRVCRDVNTRRSLGYAYVNYSSPADAARALEML 101

Query: 193 EHT-INNKKV 219
             T IN K +
Sbjct: 102 NFTPINGKPI 111



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           ++  L   + DD++R  F+E+GTI   ++  D +    +G  F+ F+S E     L +  
Sbjct: 325 YLKNLDDSVDDDKLRELFAEYGTITSCKVMRD-SNGVSRGSGFVAFKSAEDASRALAEMN 383

Query: 432 KRTIGGKEVDVKRATPKPD 488
            + +G K + V  A  K D
Sbjct: 384 SKMVGSKPLYVALAQRKED 402


>07_01_0280 + 2064865-2065080,2065442-2065531,2065690-2065893
          Length = 169

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 26/70 (37%), Positives = 38/70 (54%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +LFVG ++  T   ELR HF  YG++  I ++ D      R FAF+ F  P    + +A 
Sbjct: 10  RLFVGRVAPGTGKAELRRHFKVYGDVADIWLRHD------RPFAFVQFIQPAHAARALAD 63

Query: 190 GEHTINNKKV 219
            +H IN +KV
Sbjct: 64  KDHFINGRKV 73


>02_05_1014 + 33510108-33510471,33510857-33511362
          Length = 289

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           V  LS +T +++LR+ FG++G +    V  D  TG SRGF F+ F   E  ++ +A
Sbjct: 212 VTNLSEDTREEDLRELFGSFGPLTRAYVALDHRTGESRGFGFLSFVYREDAERAIA 267



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 1/78 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPK 434
           V  LS +  ++++R  F  FG +    +  D    + +GF F++F   E     + K   
Sbjct: 212 VTNLSEDTREEDLRELFGSFGPLTRAYVALDHRTGESRGFGFLSFVYREDAERAIAKLNG 271

Query: 435 RTIGGKEVDVKRATPKPD 488
                  ++V+ A P+P+
Sbjct: 272 YGYDSLILNVEWAAPRPN 289


>08_01_0268 -
           2167639-2167764,2167887-2167937,2169126-2169167,
           2169343-2169449,2169536-2169604,2170542-2170665
          Length = 172

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           LF+ GLS  TT   L++ F  +GE+    V TD  TG S+GF F+ +   E   K
Sbjct: 38  LFISGLSKRTTTDGLKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRYATVEDAAK 92



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           F+ GLS   + D ++  F++FG ++   +  D+     KGF F+ +
Sbjct: 39  FISGLSKRTTTDGLKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRY 84


>11_06_0728 +
           26717018-26717306,26717494-26717598,26717789-26717870,
           26717979-26718055,26719087-26719151,26719261-26719302,
           26719385-26719444,26719583-26720203,26720315-26720450,
           26720667-26720734,26720811-26720948
          Length = 560

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++FVGGL +  T+ ++R+   ++G +   ++  D  TG S+G+AF V++     D   A
Sbjct: 346 DRIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACA 405

Query: 187 A 189
           A
Sbjct: 406 A 406



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    ++ ++R     FG +   ++  D+     KG+ F  ++   V +       
Sbjct: 349 FVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALN 408

Query: 435 R-TIGGKEVDVKRA 473
              +G K + V+RA
Sbjct: 409 GIKMGDKTLTVRRA 422


>11_06_0490 -
           24293218-24293373,24293454-24293521,24293845-24293986,
           24294079-24294699,24294791-24294871,24295002-24295072,
           24296106-24296176,24296568-24296675,24296786-24297024,
           24297493-24297657
          Length = 573

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +++FVGGL +  T+ ++R+   ++G +   ++  D  TG S+G+AF V++     D   A
Sbjct: 351 DRIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACA 410

Query: 187 A 189
           A
Sbjct: 411 A 411



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL    ++ ++R     FG +   ++  D+     KG+ F  ++   V +       
Sbjct: 354 FVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALN 413

Query: 435 R-TIGGKEVDVKRATPKPDGP 494
              +G K + V+RA      P
Sbjct: 414 GIKMGDKTLTVRRANQGASQP 434


>08_02_1084 - 24232968-24234779
          Length = 603

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 1/101 (0%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AA 189
           LFVG L W TTD +L      YG ++ +    +  +G+S+G+  + F  P        A 
Sbjct: 185 LFVGELHWWTTDADLEAELIKYGPVKEVRFFDEKASGKSKGYCQVDFYDPAVATACKEAM 244

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSV 312
             H  N +      A     + + E      Q M ++TSS+
Sbjct: 245 NGHLFNGRPCVVAFASPNSVRRMGEAQVKNQQSMSAQTSSM 285



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG L    +D ++     ++G + EV    +K   + KG+C + F
Sbjct: 186 FVGELHWWTTDADLEAELIKYGPVKEVRFFDEKASGKSKGYCQVDF 231


>08_01_0620 -
           5416197-5416225,5416333-5416652,5417144-5417235,
           5417304-5417394,5417489-5417577,5417812-5417929,
           5418007-5418098,5418180-5418215,5418323-5418403,
           5418510-5418617,5418809-5418901,5419045-5419146,
           5419345-5419449,5419526-5419612,5419952-5420227
          Length = 572

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 6/104 (5%)
 Frame = +3

Query: 195 THHQQQE--SRPKEG*STTWEDFVGGLSSEISDDEIRN----FFSEFGTILEVEMPFDKT 356
           T H + +  S  K+   ++   FV G  S + + +IR      F++ G I  V +P D+ 
Sbjct: 392 TPHSRNDTGSFQKQNRGSSQSIFVKGFDSSLEESKIRESLEGHFADCGEITRVSVPMDRE 451

Query: 357 KNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 488
               KG  +I F+ +   +  L+     +GG  + V  A PK D
Sbjct: 452 TGASKGIAYIDFKDQASFSKALELSGSDLGGYNLYVDEAKPKGD 495



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 6/83 (7%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRD----HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           + +FV G      + ++R+    HF   GEI  ++V  D  TG S+G A+I FK   S  
Sbjct: 411 QSIFVKGFDSSLEESKIRESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFS 470

Query: 175 KVMAAGEHTIN--NKKVDPKKAK 237
           K +      +   N  VD  K K
Sbjct: 471 KALELSGSDLGGYNLYVDEAKPK 493



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 18/57 (31%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           LF+G LS+     ++++ F   GE+ S+ + T  + G SRGF  + F + E   K +
Sbjct: 313 LFMGNLSFNLNQDQVKEFFQEVGEVISVRLATHED-GSSRGFGHVQFASSEEAKKAL 368



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+G LS  ++ D+++ FF E G ++ V +   +  + R GF  + F S +     L+   
Sbjct: 314 FMGNLSFNLNQDQVKEFFQEVGEVISVRLATHEDGSSR-GFGHVQFASSEEAKKALELHG 372

Query: 435 RTIGGKEV 458
             + G+ V
Sbjct: 373 CDLDGRPV 380


>07_03_0824 +
           21769569-21769689,21770891-21770959,21771047-21771153,
           21771310-21771414
          Length = 133

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/51 (41%), Positives = 29/51 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           LFV GL+  TT   LR+ F  +G++    V TD  +G SRGF F+ +   E
Sbjct: 37  LFVSGLNKRTTSDGLREAFSKFGQVIEARVITDRISGYSRGFGFVKYATVE 87



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/57 (28%), Positives = 31/57 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           FV GL+   + D +R  FS+FG ++E  +  D+     +GF F+ + + +   + +K
Sbjct: 38  FVSGLNKRTTSDGLREAFSKFGQVIEARVITDRISGYSRGFGFVKYATVEEAGEGIK 94


>06_03_1263 + 28828048-28828347
          Length = 99

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG-RSRGFAFIVFKAPES 168
           +FVG +S+  T+ ELRD     G +ES+ +  D + G R RGFAF+ +   E+
Sbjct: 12  VFVGNVSYRATEAELRDACEEIGPVESLRLAVDEDAGNRRRGFAFVEYLDDET 64



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK-TKNQRKGFCFITFESEQVVNDLLKT- 428
           FVG +S   ++ E+R+   E G +  + +  D+   N+R+GF F+ +  ++      +  
Sbjct: 13  FVGNVSYRATEAELRDACEEIGPVESLRLAVDEDAGNRRRGFAFVEYLDDETARSACRNL 72

Query: 429 PKRTIGGKEVDVKRA 473
            +R + G+ + V  A
Sbjct: 73  DRRALRGRALRVDLA 87


>11_06_0418 -
           23317077-23317343,23317614-23317787,23317886-23317971,
           23318125-23318244,23318338-23318368,23318457-23318532,
           23318672-23318759,23318877-23318938,23319041-23319117,
           23319890-23319992,23320237-23320298,23321116-23321289,
           23322160-23322405
          Length = 521

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/51 (41%), Positives = 25/51 (49%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           H  +FVG L  E TD  L   F  +       V  D  TGRSRGF F+ F+
Sbjct: 243 HFNIFVGDLCPEVTDAALFAFFAGFTSCSDARVMWDQKTGRSRGFGFVSFR 293



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           S  +E  S  +  FVG L  E++D  +  FF+ F +  +  + +D+   + +GF F++F 
Sbjct: 234 STQREDTSGHFNIFVGDLCPEVTDAALFAFFAGFTSCSDARVMWDQKTGRSRGFGFVSFR 293

Query: 396 SEQ-VVNDLLKTPKRTIGGKEVDVKRAT 476
           ++Q   N + +   + +G ++V    AT
Sbjct: 294 NQQDAQNAINELNGKWLGNRQVRCNWAT 321



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEF--GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           +VG L  +++ +++  FF     G+I EV +  D      KGF F+ + + +     ++T
Sbjct: 368 YVGNLPHDVNSNDVHRFFHSLGVGSIEEVRVTRD------KGFGFVRYSTHEEAALAIQT 421

Query: 429 PK-RTIGGKEVDVKRATPKPDGPG 497
              + IGG+++     + KP  PG
Sbjct: 422 GNGQLIGGRQIKCSWGS-KPTPPG 444


>08_02_1064 -
           24033941-24034127,24034432-24034476,24035355-24035421,
           24035521-24035600,24035691-24035769,24035864-24035939
          Length = 177

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L V  +S+ TT  +L   F  YG++  + +  D  TG SRGFAF+ +K  E   K +
Sbjct: 18  LLVLNISFRTTADDLFPLFDRYGKVVDVFIPRDRRTGDSRGFAFVRYKYAEEAQKAI 74


>07_01_0413 -
           3155080-3155274,3155628-3155933,3156062-3156163,
           3156262-3156705
          Length = 348

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +LFVG L +  T  E+   F   G ++++ +  D  T RSRGFAF+     E
Sbjct: 119 RLFVGNLPYTMTSGEISQTFSEAGRVDNVQIIYDKVTDRSRGFAFVTMATAE 170



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG L   ++  EI   FSE G +  V++ +DK  ++ +GF F+T   +E+    +    
Sbjct: 121 FVGNLPYTMTSGEISQTFSEAGRVDNVQIIYDKVTDRSRGFAFVTMATAEEAATAIQMFN 180

Query: 432 KRTIGGKEVDV 464
              +GG+   V
Sbjct: 181 GALLGGRTARV 191



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++ G L W      LR  F     +    V  + ++GRSRGF F+ F+  E     + A
Sbjct: 221 KIYAGNLGWGVRADALRAAFEGQPGLLDARVIFERDSGRSRGFGFVSFRTAEDAQAALEA 280


>05_04_0101 -
           18003528-18003655,18003951-18003997,18004046-18004077,
           18004316-18004453,18004579-18004619,18004967-18005105,
           18010981-18011057,18011804-18011858,18012976-18013021,
           18013099-18013187,18013304-18013417
          Length = 301

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 4/83 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FV  +     + + R HF A+GEI  + +  +  +   RG  FI F++ E +D +M  
Sbjct: 51  RIFVARIPQSVDESKFRRHFEAFGEIIDLYMPKELRSKSHRGIGFITFRSAECVDNIMQE 110

Query: 190 GEH----TINNKKVDPKKAKARH 246
                  T+   +  PK    RH
Sbjct: 111 THELDGTTVAVDRATPKDEDVRH 133


>03_06_0507 +
           34404843-34404968,34405091-34405151,34405260-34405296,
           34405365-34405386,34405861-34405957,34406037-34406180,
           34407034-34407173,34408205-34408255,34408347-34408429,
           34408515-34408590,34408646-34408760,34409080-34409575,
           34409682-34409895,34410000-34410070,34410527-34410695,
           34410787-34410916,34411330-34411742,34411839-34412039
          Length = 881

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 25/96 (26%), Positives = 49/96 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +F+  L ++ +++E+ + F A+G++ES        T R RG  F+ F   E+ D  ++A 
Sbjct: 447 IFICNLPFDLSNEEVTERFSAFGKVESFFPVLHKLTKRPRGTGFLKFSTAEAADAAVSAA 506

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
            +      +  K    +  K L ++SA K ++ KS+
Sbjct: 507 -NAAPGLGIFIKSRALKIMKALDKESAHKKELEKSK 541



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 19/70 (27%), Positives = 34/70 (48%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  ++ V  L ++ T KE+ D F   G +  +++    + G S+GFAF+ F   +  + V
Sbjct: 214 RKWRVIVRNLPFKITVKEIMDMFSLAGFVWDVSIPQKSDNGTSKGFAFVSFTRKQDAENV 273

Query: 181 MAAGEHTINN 210
            +     I N
Sbjct: 274 WSVPCSAIKN 283



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 2/76 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  L       ++   FSE G +    M   K     +GF F+     Q++  LL   K
Sbjct: 30  FVSNLPYTFKSADLEAVFSEVGPVRRCFMVAPKGSETSRGFGFV-----QLIPQLLLIQK 84

Query: 435 R--TIGGKEVDVKRAT 476
              ++ G+++ VK AT
Sbjct: 85  DGFSVAGRKIRVKLAT 100


>02_04_0289 +
           21615745-21616155,21617417-21617870,21618162-21618217,
           21618307-21618437,21618565-21618727
          Length = 404

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG L+ + TD+ L D F   Y  ++   V  D NTGRSRG+ F+ F
Sbjct: 207 IFVGDLAVDVTDEMLMDLFAKKYRSVKGAKVIIDANTGRSRGYGFVRF 254



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           R  +  ST    +VGGL    ++DE+R  F+++G +  V++P  K
Sbjct: 297 RQSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGK 341



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 20/69 (28%), Positives = 33/69 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VGGL    T+ ELR  F  YG++ S+ +      G+  GF   V   P++ + +    
Sbjct: 308 IYVGGLDPNATEDELRKAFAKYGDLASVKIP----VGKQCGFVQFV-NRPDAEEALQGLN 362

Query: 193 EHTINNKKV 219
             TI  + V
Sbjct: 363 GSTIGKQAV 371


>09_04_0506 - 18188785-18190599
          Length = 604

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 1/101 (0%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AA 189
           LFVG L W TTD +L      YG+++ +    +  +G+S+G+  + F  P +        
Sbjct: 187 LFVGELHWWTTDADLEAELSKYGQVKEVRFFDEKASGKSKGYCQVDFYDPGAAASCKEGM 246

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSV 312
             H  N +      A     + + E      Q M  + S V
Sbjct: 247 NGHLFNGRPCVVAFASPHTVRRMGEAQVKNQQSMAQQNSGV 287



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG L    +D ++    S++G + EV    +K   + KG+C + F
Sbjct: 188 FVGELHWWTTDADLEAELSKYGQVKEVRFFDEKASGKSKGYCQVDF 233


>04_04_1121 -
           31041629-31041793,31041891-31042022,31042255-31042425,
           31042521-31042622,31042703-31042807,31043115-31043286,
           31043916-31043980,31044179-31044502,31044729-31044846,
           31044928-31045011,31045472-31045603,31045714-31046570,
           31046735-31046849,31047371-31047481,31047763-31047824
          Length = 904

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/97 (21%), Positives = 43/97 (44%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +LF   L + TT+ +L +    YG+++   +  D  T  S G  +++F  P+S  + +  
Sbjct: 371 RLFFCNLPYATTEGDLVELCSQYGDVDQARIVVDKTTKLSTGRGYVLFSLPDSAVRALEL 430

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
              +   + +  K AK  + K +      K   +K +
Sbjct: 431 DNSSFQGRLLRVKAAKPLNNKKIESSYEEKKMSLKQQ 467



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL V  +++E T+K+LR  F  +G+I+S+ +      G  RGFAF+ F   +     + A
Sbjct: 782 KLLVRNVAFEATEKDLRQLFSPFGQIKSLRLPM--KFGSHRGFAFVEFVTKQEAQNALQA 839



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGA---YGEIESINVKTDPNTGR--SRGFAFIVFKAPESIDK 177
           +FV  L+++T+D+ L+ HF      G ++S  VK     G+  S GF F+ F + E+   
Sbjct: 684 VFVKNLNFKTSDESLKQHFSTKLKSGSLKSATVKKHIKNGKNVSMGFGFVEFDSVETATS 743

Query: 178 V 180
           V
Sbjct: 744 V 744



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L V  L     +  LR+ F   GE+    V    + G+SR FAF+ F+  E  ++ +
Sbjct: 24  RLCVKNLPKGADEGRLREVFSRKGEVTDAKVIRTKD-GKSRQFAFVGFRTNEEAEEAL 80


>03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594
          Length = 323

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 21/94 (22%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI---------------ESINVKTDPNTGRSRGFAF 144
           ++FVGGLS+ T +++L D F  +G++               + I +  + +T R RGF F
Sbjct: 8   RIFVGGLSFHTDERKLADAFRRFGKVVDAQWFGSFCGSFVNQVILIMLERHTQRHRGFGF 67

Query: 145 IVFKAPESID---KVMAAGE---HTINNKKVDPK 228
           + F  PE++D   K M   E    TI+  K +PK
Sbjct: 68  VTFSDPEAVDSAIKEMHCQELDGRTISVNKAEPK 101



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 16/92 (17%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVE---------------MPFDKTKNQRKGFCFIT 389
           FVGGLS    + ++ + F  FG +++ +               +  ++   + +GF F+T
Sbjct: 10  FVGGLSFHTDERKLADAFRRFGKVVDAQWFGSFCGSFVNQVILIMLERHTQRHRGFGFVT 69

Query: 390 FESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 482
           F   + V+  +K    + + G+ + V +A PK
Sbjct: 70  FSDPEAVDSAIKEMHCQELDGRTISVNKAEPK 101


>01_07_0362 +
           43063345-43063420,43064176-43064244,43064348-43064454,
           43064561-43064608
          Length = 99

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +1

Query: 28  LSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 207
           LS++T +  L+D F  +G I  + V   P TG+S+G+ F+ F + +      AA  H + 
Sbjct: 27  LSYDTNETALKDAFSQHGHIIQVKVICHPVTGKSKGYGFVKFASEDE----AAAALHKMG 82

Query: 208 NKKVDPKKAKARH 246
            + +D +  +  +
Sbjct: 83  GEVIDGRNIRVHY 95



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +3

Query: 267 LSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTPKRTI 443
           LS + ++  +++ FS+ G I++V++       + KG+ F+ F SE +    L K     I
Sbjct: 27  LSYDTNETALKDAFSQHGHIIQVKVICHPVTGKSKGYGFVKFASEDEAAAALHKMGGEVI 86

Query: 444 GGKEVDVKRA 473
            G+ + V  A
Sbjct: 87  DGRNIRVHYA 96


>01_07_0120 +
           41185884-41186127,41187228-41187310,41188596-41188647,
           41188729-41188854,41188967-41189049,41189308-41189490,
           41189901-41190237,41190607-41190750,41190854-41190939,
           41191069-41191113
          Length = 460

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 30/104 (28%), Positives = 42/104 (40%), Gaps = 2/104 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+G L    TD EL D F  YG I+ + +          G AF+ ++  E     + A
Sbjct: 129 KLFIGMLPKNVTDTELTDLFSKYGNIKDLQILRGSQQTSKAGCAFLKYETKEQAVAAIEA 188

Query: 190 --GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
             G+H I    V      A   K      A K+Q+  S   S +
Sbjct: 189 LNGKHKIEGSSVPLVVKWADTEKERQARKAQKAQLQSSNMPSAS 232



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG +    T+ EL   F     ++ + V  D  T  SRG  F++  + E  DK + A
Sbjct: 41  KLFVGQVPKHMTEAELLAMFQEVAIVDEVTVIKDKATKASRGCCFLICPSREEADKAVNA 100

Query: 190 --GEHTINNKKVDPKKAKARHGKI 255
              +HT+      P + K   G++
Sbjct: 101 YHNKHTLPGAS-SPLQVKYADGEL 123



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/50 (28%), Positives = 24/50 (48%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVG +   +++ E+   F E   + EV +  DK     +G CF+   S +
Sbjct: 43  FVGQVPKHMTEAELLAMFQEVAIVDEVTVIKDKATKASRGCCFLICPSRE 92


>04_04_0176 - 23329589-23331043
          Length = 484

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+G L + TTD E+      +G +  ++  TD  TG+SRGF    F +P++     AA
Sbjct: 126 VFIGELPYWTTDAEVEGALAPHGALHGLHFFTDKLTGKSRGFCRADFLSPDAAASAAAA 184


>07_03_1316 +
           25736931-25737206,25737276-25737329,25738036-25738189,
           25740235-25740313,25740413-25740492,25740588-25740654,
           25741548-25741619,25742071-25742223,25742309-25742392,
           25742811-25742877
          Length = 361

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 8/81 (9%)
 Frame = +1

Query: 40  TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK----APESID----KVMAAGE 195
           TT  +L   F  YGE+  I +  D  TG SRGFAF+ +K    A +++D    +V+   E
Sbjct: 163 TTADDLSPLFEKYGEVVDIYIPRDRRTGDSRGFAFVRYKYEDEAQKAVDRLDGRVVDGRE 222

Query: 196 HTINNKKVDPKKAKARHGKIL 258
             +   K  P   +   GKI+
Sbjct: 223 IMVQFAKYGPNAERIHKGKIM 243


>04_03_0282 -
           13874547-13874738,13875047-13875134,13875222-13875328,
           13875487-13875542,13875853-13875882,13877397-13877505,
           13877774-13878318,13879584-13879668,13879753-13879914,
           13880293-13880434,13880524-13880624,13882307-13882489
          Length = 599

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAA 189
           + V  + +  T + L  HF   G +  IN+ TD  +G  +G AF+ F   ES++K V  +
Sbjct: 467 VLVTNVHFAATKEALSGHFMKCGTVLKINILTDAISGHPKGAAFVTFTDKESVEKAVSLS 526

Query: 190 GEHTINNKKVDPKKAKARHGKILS 261
           G    +      +KA+A  G + S
Sbjct: 527 GSSFFSRVLTVMRKAEAPPGFLAS 550



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 15/68 (22%), Positives = 29/68 (42%)
 Frame = +3

Query: 288 DEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVK 467
           + +   F + GT+L++ +  D      KG  F+TF  ++ V   +     +   + + V 
Sbjct: 479 EALSGHFMKCGTVLKINILTDAISGHPKGAAFVTFTDKESVEKAVSLSGSSFFSRVLTVM 538

Query: 468 RATPKPDG 491
           R    P G
Sbjct: 539 RKAEAPPG 546


>03_03_0192 -
           15308602-15308869,15309457-15309528,15310271-15310337,
           15310449-15310528,15310636-15310714,15310815-15310890
          Length = 213

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 8/94 (8%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK----APESIDKV 180
           L V  +S+ TT  +L   F   GE+  I +  D  TG SRGFAF+ +K    A +++DK+
Sbjct: 18  LLVLNVSFRTTADDLLALFDRCGEVLDIRIPRDRRTGDSRGFAFVRYKYEDEAQKAVDKL 77

Query: 181 ----MAAGEHTINNKKVDPKKAKARHGKILSEDS 270
               +   +  +   K  P   +   G+I+ E S
Sbjct: 78  DGRTVDGRDIMVQFAKYGPNAERIHKGRIVEEIS 111


>08_02_0162 +
           13464698-13464974,13465719-13465837,13465920-13466579,
           13466686-13466763,13466849-13466938,13467241-13467378,
           13467730-13467738
          Length = 456

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+VG L     D +L D F   G + S+ V  D NT  S G+A++ F +P    + +   
Sbjct: 41  LYVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRLSLGYAYVNFSSPADAARALEML 100

Query: 193 EHT-INNKKV 219
             T IN K +
Sbjct: 101 NFTPINGKPI 110



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 46  DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           D++L++ F  +G I S  V  D N G S+G  F+ FK+ E   + + A
Sbjct: 335 DEKLKEIFADFGTITSCKVMRDLN-GVSKGSGFVAFKSAEDASRALVA 381



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L   + D ++ + FS+ G+++ V +  D       G+ ++ F S       L+   
Sbjct: 42  YVGDLDVSVQDAQLFDVFSQVGSVVSVRVCRDVNTRLSLGYAYVNFSSPADAARALEMLN 101

Query: 435 RT-IGGKEVDVKRATPKP 485
            T I GK + +  +   P
Sbjct: 102 FTPINGKPIRIMYSNRDP 119


>06_01_0493 -
           3536207-3537056,3537603-3537826,3538234-3538503,
           3539042-3539146
          Length = 482

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 27/80 (33%), Positives = 40/80 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L++GGL+   T+++LRD F A+GEIESI +         R  AF+ +   E  +K   A 
Sbjct: 230 LYIGGLNNRITEQDLRDQFYAHGEIESIRMVL------QRACAFVTYTTREGAEK---AA 280

Query: 193 EHTINNKKVDPKKAKARHGK 252
           E   N   +   + K   GK
Sbjct: 281 EELANKLVIKGIRLKLMWGK 300


>05_04_0092 +
           17851085-17851346,17852778-17852860,17853891-17853942,
           17854054-17854179,17854291-17854373,17855127-17855309,
           17855731-17855947,17856156-17856299,17856375-17856446,
           17857166-17857230,17857517-17857584,17857968-17858007,
           17858843-17859013
          Length = 521

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 30/104 (28%), Positives = 42/104 (40%), Gaps = 2/104 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLF+G L    TD E+ D F  YG I+ + +          G AF+ ++  E     + A
Sbjct: 135 KLFIGMLPKNVTDAEMTDLFSQYGNIKDLQILRGSQQTSKAGCAFLKYETKEQALAAIEA 194

Query: 190 --GEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
             G+H I    V      A   K      A K+Q   S  S+ N
Sbjct: 195 LNGKHKIEGSSVPLVVKWADTEKERQARKAQKAQFHPSNMSNPN 238



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFVG +  + T+ EL   F A   ++ + +  D  T  SRG  F++  + E  DK + A
Sbjct: 47  KLFVGQVPKQMTEDELAAMFAAVAVVDEVTLIRDKATKASRGCCFLICPSREEADKAVNA 106



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-- 428
           FVG +  ++++DE+   F+    + EV +  DK     +G CF+   S +  +  +    
Sbjct: 49  FVGQVPKQMTEDELAAMFAAVAVVDEVTLIRDKATKASRGCCFLICPSREEADKAVNAYH 108

Query: 429 PKRTIGG 449
            KRT+ G
Sbjct: 109 NKRTLPG 115



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 12/50 (24%), Positives = 30/50 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+G L   ++D E+ + FS++G I ++++     +  + G  F+ +E+++
Sbjct: 137 FIGMLPKNVTDAEMTDLFSQYGNIKDLQILRGSQQTSKAGCAFLKYETKE 186


>04_04_0053 +
           22389227-22389613,22390528-22390981,22391618-22391673,
           22391757-22391887,22391976-22392072,22393329-22393484
          Length = 426

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG L+ + TD+ L + F   Y  ++   V  D NTGRSRG+ F+ F
Sbjct: 199 IFVGDLAADVTDEMLMELFANKYRSVKGAKVIIDANTGRSRGYGFVRF 246



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +G ST    +VGGL   +S+DE+R  F+++G +  V++P  K
Sbjct: 292 DGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGK 333



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 18/60 (30%), Positives = 33/60 (55%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++ ++VG L +   +  L   FG  GE+ +I V  +  TG+S G+ F+ F +  S +K +
Sbjct: 103 NKTIWVGDLQYWMDENYLHSCFGPSGEVVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKAL 162



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 123
           ++VGGL    ++ ELR  F  YG++ S+ +      G
Sbjct: 300 VYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCG 336


>03_05_0235 - 22214700-22214914,22218782-22219045,22219258-22219294
          Length = 171

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VGGL+ E+ +  +   F  FG I +V+ P D+   + + F F+TF E E     +    
Sbjct: 11  YVGGLAEEVDEKILHAAFVPFGEIKDVKTPLDQATQKHRSFGFVTFLEREDAAAAMDNMD 70

Query: 432 KRTIGGKEVDVKRATPK 482
              + G+ + V  A P+
Sbjct: 71  GAELFGRVLTVNYAFPE 87



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/57 (35%), Positives = 28/57 (49%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L+VGGL+ E  +K L   F  +GEI+ +    D  T + R F F+ F   E     M
Sbjct: 10  LYVGGLAEEVDEKILHAAFVPFGEIKDVKTPLDQATQKHRSFGFVTFLEREDAAAAM 66


>01_06_0006 -
           25517892-25517935,25518156-25518276,25518598-25518733,
           25519189-25519280,25519358-25519426,25519710-25519821,
           25519897-25520015,25520302-25520355,25520811-25520891,
           25520968-25521051,25521124-25521315,25521633-25521746,
           25521832-25521978,25522066-25522302,25522762-25522810,
           25522894-25523027,25523124-25523324,25523532-25523701,
           25523773-25523875,25524198-25524361,25525015-25525055,
           25525144-25525187
          Length = 835

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR-T 440
           GL   +S+D+I +FFS +GT+++ ++         +G  F+ F SE  V  +L       
Sbjct: 110 GLPWTVSNDDIVHFFSPYGTVVDHQITQKDENKLSEGSGFVLFSSELAVIKILSNGNTVN 169

Query: 441 IGGKEVDVKRA 473
           +GG++V + R+
Sbjct: 170 LGGEKVSINRS 180



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/68 (20%), Positives = 34/68 (50%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + ++ + GL W  ++ ++   F  YG +    +        S G  F++F +  ++ K++
Sbjct: 103 NRRITLDGLPWTVSNDDIVHFFSPYGTVVDHQITQKDENKLSEGSGFVLFSSELAVIKIL 162

Query: 184 AAGEHTIN 207
           + G +T+N
Sbjct: 163 SNG-NTVN 169


>11_01_0236 +
           1811822-1812971,1814930-1814979,1815676-1816116,
           1816199-1816309,1816934-1817074,1817153-1817323,
           1817421-1817625,1817714-1817886,1817997-1818079,
           1818487-1818626,1818806-1818891,1818957-1819142,
           1819172-1819365,1820387-1820736,1821153-1821235
          Length = 1187

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/79 (25%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           E +VGG+SS++S ++++      G ++EV M   + K+  +G+ F+ F ++ +   ++K 
Sbjct: 520 EVYVGGISSDVSSEDLKRLCEPVGEVVEVRMM--RGKDDSRGYAFVNFRTKGLALKVVKE 577

Query: 429 PKRT-IGGKEVDVKRATPK 482
                + GK + V  +  K
Sbjct: 578 LNNAKLKGKRIRVSSSQAK 596



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/76 (26%), Positives = 40/76 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +++VGG+S + + ++L+      GE+  + V+       SRG+AF+ F+      KV+  
Sbjct: 520 EVYVGGISSDVSSEDLKRLCEPVGEV--VEVRMMRGKDDSRGYAFVNFRTKGLALKVV-- 575

Query: 190 GEHTINNKKVDPKKAK 237
               +NN K+  K+ +
Sbjct: 576 --KELNNAKLKGKRIR 589


>09_01_0112 +
           1737438-1737777,1738441-1738511,1738974-1739052,
           1741559-1741641,1741733-1741784,1742038-1742105,
           1742279-1742345,1742426-1742505,1742576-1742640,
           1742785-1742847,1743271-1743427,1743511-1743588,
           1743677-1744219,1744321-1744497,1744534-1744788,
           1745270-1745329,1745874-1745888,1746123-1746135,
           1746819-1746934
          Length = 793

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KLFV  L+ + T KE+ + F  YG +E + +  D    +SRG  F+ F + E     M+A
Sbjct: 214 KLFVASLNKQATAKEIEEIFAPYGHVEDVYIMKD-GMRQSRGCGFVKFSSREPALAAMSA 272



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 13/50 (26%), Positives = 30/50 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+G +    ++D++R  F E G ++EV +  D+   +++G CF+ + + +
Sbjct: 125 FIGSVPRTATEDDVRPLFEEHGDVVEVALIKDRKTGEQQGCCFVKYATSE 174


>07_03_1586 -
           27929947-27930056,27930143-27930286,27930377-27930704,
           27931189-27931404,27932099-27932284,27932439-27932521,
           27932621-27932752,27932943-27932999,27933352-27933412,
           27933807-27933889,27933975-27934134
          Length = 519

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  +  E  D+++ N F EFG IL  ++  D+     K F F+++++       ++   
Sbjct: 443 FVYDIPQEYGDEDLANLFQEFGRILSTKVFIDRATGVSKCFGFVSYDTPASAQAAIRRMN 502

Query: 435 RT-IGGK--EVDVKRAT 476
            + IGGK  +V +KR T
Sbjct: 503 GSQIGGKMLKVQLKRET 519



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +LFVG +     ++++     A    +   V  D  TG SRG  F+V  + E  DK +AA
Sbjct: 13  RLFVGQVPRSMAEEDILAVVRAAARADDATVIRDRATGASRGCCFVVCSSREEADKAIAA 72



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +KLF+G L  +  + E+   F  YG I  + V   P   R +  A + F + E
Sbjct: 124 QKLFIGMLPRDVKENEVSALFSQYGNIRQLKVLRSPQKTR-KACAILEFGSKE 175



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/50 (24%), Positives = 28/50 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           F+G L  ++ ++E+   FS++G I ++++     +  RK    + F S++
Sbjct: 127 FIGMLPRDVKENEVSALFSQYGNIRQLKV-LRSPQKTRKACAILEFGSKE 175


>07_01_1143 -
           10711023-10711884,10713603-10713826,10714253-10714522,
           10715071-10715175
          Length = 486

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L++GGL    T+++LRD F A+GEIE+I +         R  AF+ +   E  +K   A 
Sbjct: 230 LYIGGLDSRVTEQDLRDQFYAHGEIETIRMVL------QRACAFVTYTTREGAEK---AA 280

Query: 193 EHTINNKKVDPKKAKARHGK 252
           E   N   +   + K   GK
Sbjct: 281 EELANKLVIKGVRLKLMWGK 300


>05_04_0383 -
           20801036-20801309,20801413-20801538,20801706-20801730,
           20801808-20802259,20802330-20802394,20802487-20802711,
           20804750-20804878,20805095-20805306,20806861-20806894
          Length = 513

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 14/57 (24%), Positives = 32/57 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F+G L  ++ +  +     + G ++++ +P DK  N+ KG+ F  +E+E++    +K
Sbjct: 10  FIGNLDEKVPERVLYEILIQVGRVVDLHIPRDKETNRSKGYAFAEYETEEIAQYAVK 66



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 13/51 (25%), Positives = 27/51 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +F+G L  +  ++ L +     G +  +++  D  T RS+G+AF  ++  E
Sbjct: 9   VFIGNLDEKVPERVLYEILIQVGRVVDLHIPRDKETNRSKGYAFAEYETEE 59


>03_05_0067 - 20460206-20460703,20461255-20461530
          Length = 257

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG L+ + TD  L+D F A Y  ++   V  D +TGRS+G+ F+ F
Sbjct: 162 IFVGDLASDVTDLILQDTFKAHYQSVKGAKVVFDRSTGRSKGYGFVKF 209



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 13/47 (27%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFF-SEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG L+S+++D  +++ F + + ++   ++ FD++  + KG+ F+ F
Sbjct: 163 FVGDLASDVTDLILQDTFKAHYQSVKGAKVVFDRSTGRSKGYGFVKF 209



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/57 (26%), Positives = 29/57 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L++G L +   +  L + F   GE+ S  +  +  TG+  G+ FI F +    ++V+
Sbjct: 69  LWIGDLQFWMEENYLYNCFSQAGELISAKIIRNKQTGQPEGYGFIEFGSHAIAEQVL 125


>02_05_1015 + 33512023-33512359,33513550-33514082
          Length = 289

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           V  LS +T + +L + F  +G +  + V  D  TG SRGF F+ F   E  +K ++
Sbjct: 212 VTNLSEDTREPDLLELFRTFGPVSRVYVAVDQKTGASRGFGFVNFVHREDAEKAIS 267


>02_02_0008 +
           6061508-6061624,6062468-6062566,6062636-6063039,
           6064218-6064278,6064413-6064466,6064786-6064854,
           6064993-6065058,6065162-6065230,6065448-6065537
          Length = 342

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/69 (28%), Positives = 36/69 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VGGL +E  +  LRD FG +G I S+ V  D    R + + F+ F   ++    ++  
Sbjct: 11  VYVGGLPYEANEDMLRDAFGRFGTIVSVKVINDQRV-RGKCYGFVTFTHADAAQHAISGM 69

Query: 193 EHTINNKKV 219
           +    N++V
Sbjct: 70  DGKRINRRV 78



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 18/46 (39%), Positives = 31/46 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           +VGGL  E ++D +R+ F  FGTI+ V++  D+ + + K + F+TF
Sbjct: 12  YVGGLPYEANEDMLRDAFGRFGTIVSVKVINDQ-RVRGKCYGFVTF 56


>12_01_0234 +
           1755704-1756120,1756203-1756313,1756923-1757063,
           1757142-1757312,1757412-1757616,1757738-1757910,
           1758021-1758103,1758250-1758389,1758569-1758645,
           1758711-1758810,1759978-1760606
          Length = 748

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           E +VGG+SS++S ++++      G ++EV M   + K+  +G+ F+ F ++ +    +K 
Sbjct: 112 EVYVGGISSDVSSEDLKRLCEPVGEVVEVRMM--RGKDDSRGYAFVNFRTKGLALKAVKE 169

Query: 429 PKRT-IGGKEVDVKRATPK 482
                + GK + V  +  K
Sbjct: 170 LNNAKLKGKRIRVSSSQAK 188



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/80 (21%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMA 186
           +++VGG+S + + ++L+      GE+  + V+       SRG+AF+ F+    ++  V  
Sbjct: 112 EVYVGGISSDVSSEDLKRLCEPVGEV--VEVRMMRGKDDSRGYAFVNFRTKGLALKAVKE 169

Query: 187 AGEHTINNKKVDPKKAKARH 246
                +  K++    ++A++
Sbjct: 170 LNNAKLKGKRIRVSSSQAKN 189


>04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276
          Length = 924

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           KL+V  LS       L   F  +GE+ +  V  D  TG S+G+ F+ + +P    + +  
Sbjct: 305 KLYVCNLSLSMNTDRLIHLFLPFGEVTNAKVAKDHTTGLSKGYGFVQYSSPHHAAEAVI- 363

Query: 190 GEHTINNKKVDPKKAKARHGKILS--EDSAVKS 282
             H +N + VD +K + R   I S   +SAV+S
Sbjct: 364 --H-LNGRLVDGRKIEVRVSGIPSTLPNSAVES 393



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 1/103 (0%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+VG L       +L + F  +G+I    V  D  TG S+G+ F+ +  P    + +   
Sbjct: 211 LYVGNLPASVGSHKLIELFLPFGQIVRSRVVDDCFTGLSQGYGFVKYSDPRCASEAI--- 267

Query: 193 EHTINNKKVDPKKAKAR-HGKILSEDSAVKSQMMKSETSSVNL 318
              +N + V+    K R  G   SED+   SQ    ET    L
Sbjct: 268 -KRMNGRLVEGTALKVRVTGFPSSEDN---SQQPSKETDMAKL 306



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L+V  L     ++ L D F   G+I    V  +  TG S+GF F+ F
Sbjct: 702 LYVSHLPSYVNNERLIDLFLPCGQITQAKVVVERYTGVSKGFGFVKF 748


>02_01_0251 -
           1652356-1652522,1652564-1652608,1652658-1652733,
           1652976-1653041,1653120-1653238,1653334-1653508,
           1653604-1653881,1654253-1654436,1654455-1654550,
           1654872-1655012,1655091-1655123
          Length = 459

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/75 (25%), Positives = 37/75 (49%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG + S +S+ ++ N F +FG ++   +     K     + F+ FE    V++ LK   
Sbjct: 308 YVGNVPSSVSEADLENEFKKFGRLIPDGVAIRSRKETGGYYAFVEFEELSGVHNALKASP 367

Query: 435 RTIGGKEVDVKRATP 479
             I G+++ V+   P
Sbjct: 368 IEINGRQIYVEERKP 382


>08_02_0651 -
           19714348-19714395,19715319-19715429,19715503-19715572,
           19716081-19716178,19716272-19716319,19716391-19716446,
           19718191-19718314,19718417-19718506
          Length = 214

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/66 (24%), Positives = 39/66 (59%)
 Frame = +3

Query: 210 QESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT 389
           +E +P+E  +T+   ++G +     +++++ FF +FGT+  + +  ++   + K + FI 
Sbjct: 42  REEQPEEPENTSTVLYIGHIPHGFYEEQMQGFFQQFGTVKRLRIARNRKTGKSKHYGFIE 101

Query: 390 FESEQV 407
           FE+ +V
Sbjct: 102 FENPEV 107



 Score = 35.9 bits (79), Expect = 0.027
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 7/80 (8%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA-- 186
           L++G +     +++++  F  +G ++ + +  +  TG+S+ + FI F+ PE + K++A  
Sbjct: 56  LYIGHIPHGFYEEQMQGFFQQFGTVKRLRIARNRKTGKSKHYGFIEFENPE-VAKIVADE 114

Query: 187 -----AGEHTINNKKVDPKK 231
                  EHT+    V P+K
Sbjct: 115 MNNYLLFEHTLQIAIVPPEK 134


>02_04_0589 -
           24117688-24119282,24119881-24119908,24120004-24120089,
           24120196-24120220,24121188-24121326,24122344-24122567,
           24122674-24122691
          Length = 704

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           +VG +S   ++++    FS  G I ++ M  DK      GFCFI + S +   D +K
Sbjct: 37  YVGNMSFYTTEEQAYELFSRAGEIRKIIMGLDKNSKTPCGFCFILYYSREDAEDAVK 93



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 17/54 (31%), Positives = 31/54 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           ++VG +S+ TT+++  + F   GEI  I +  D N+    GF FI++ + E  +
Sbjct: 36  VYVGNMSFYTTEEQAYELFSRAGEIRKIIMGLDKNSKTPCGFCFILYYSREDAE 89


>09_04_0424 +
           17444261-17444665,17445974-17446367,17447367-17447425,
           17447507-17447637,17447737-17447833,17447936-17448100
          Length = 416

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/60 (30%), Positives = 34/60 (56%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++ ++VG L +   +  L   FG  GE+ +I V  +  TG+S G+ F+ F +  + +KV+
Sbjct: 109 NKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVL 168



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG L+ +  D  L + F   Y  ++   V  D NTGRS+G+ F+ F
Sbjct: 205 IFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDANTGRSKGYGFVRF 252



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           +G  T    FVGGL   +S+D++R  FS++G I  V++P  K
Sbjct: 279 DGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGK 320



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 123
           +FVGGL    ++ +LR  F  YGEI S+ +      G
Sbjct: 287 VFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCG 323


>08_01_0098 -
           700443-700660,701112-701268,701586-701678,701763-702149,
           702755-702829,703486-703609,703693-703832,703904-703993,
           704254-704298,704917-705042,705138-705272,705966-706451,
           706539-706596,706728-706855,707209-707463
          Length = 838

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 6/92 (6%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 195
           ++  +     ++ +R  F   G + +I +  D  T +SRG A++ F   E ++  +   +
Sbjct: 676 YMSNIDLTANEEHIRRFFSDIGGVTAIRLLRDKFTKKSRGIAYVDFSDNEHLEAAIRKNK 735

Query: 196 HTINNKKV-----DPKKAKA-RHGKILSEDSA 273
           H +  KKV     DP K K  R     S+D A
Sbjct: 736 HKLLAKKVSVARSDPSKGKKNREAGSFSKDQA 767


>03_02_0967 +
           12786219-12786305,12786716-12786781,12786897-12786971,
           12787054-12787162,12787253-12787299,12787396-12787453,
           12788193-12788242,12788459-12788504,12788758-12788808,
           12789376-12789478,12789923-12789956,12790210-12790224
          Length = 246

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++VG L  +  ++E+ D F  YG I  I++K  P   R  G+AF+ F+ P   ++  A
Sbjct: 9   IYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPP---RPPGYAFVEFEDPRDAEEACA 63


>09_06_0188 - 21441377-21442201
          Length = 274

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++V  L +  T+ +L   F  +G +  + V  D ++ RSRG AF++F   E  D   AA 
Sbjct: 72  VYVSNLDFALTNSDLHTLFSRFGRVARVTVLKDRDSRRSRGVAFVLFVRRE--DAAAAAA 129

Query: 193 E 195
           E
Sbjct: 130 E 130


>02_01_0500 -
           3623837-3624019,3624591-3624778,3625209-3626147,
           3626311-3626479,3626701-3626871,3626948-3627016,
           3627094-3627201,3627844-3627997,3628659-3628738,
           3628822-3628914,3628951-3629073,3629165-3629915,
           3630123-3630163,3630338-3630385
          Length = 1038

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 3/84 (3%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL     ++ LR  F  +  I+ I +  D  T  SRGFAFI F + E   K + A 
Sbjct: 441 LVVRGLDENADEEMLRYEFAKHAPIKDIRLVRDKFTHVSRGFAFIHFHSVEEATKALEAT 500

Query: 193 EHTI---NNKKVDPKKAKARHGKI 255
                  N + +    AK+ HG +
Sbjct: 501 NGITLEKNGQVLRVTYAKSTHGPV 524



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 76  YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +G + S+ V  + ++G SRGFAFI F   E+  ++M
Sbjct: 324 WGPLRSVRVIKERSSGMSRGFAFIDFPTVEAARRMM 359


>06_03_0614 -
           22753092-22753349,22754059-22754277,22754712-22754960,
           22755186-22755275,22755379-22755456,22755562-22756337,
           22757042-22757384
          Length = 670

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 20/56 (35%), Positives = 28/56 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           F+  L   I +  +   FS FGTIL  ++  D    + KG+ FI FESE    D +
Sbjct: 152 FIKNLEPNIDNKSLYEMFSSFGTILSSKVATD-FNGKSKGYGFIQFESESSAKDAI 206


>01_06_0834 +
           32302065-32302143,32303136-32303275,32303371-32303436,
           32303867-32303950,32304532-32304699,32305061-32305126,
           32306027-32306452
          Length = 342

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +1

Query: 52  ELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 222
           +L+++F  +GE+    V TD NT   RGF  I F + ES  + +    H +  + V+
Sbjct: 123 KLKEYFSNFGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRHFLCGQWVE 179



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +3

Query: 291 EIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDV 464
           +++ +FS FG +    +  D      +GF  I F SE+     LK  +  + G+ V+V
Sbjct: 123 KLKEYFSNFGEVNRAIVVTDLNTKMPRGFGLIQFASEESTARALKKDRHFLCGQWVEV 180


>06_01_1003 - 7798800-7799444
          Length = 214

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKT-DPNTGRSRGFAFIVFKAPES 168
           ++VG +++  T+ ELRD     G + S+ +   DP T + +G+AF+ +   E+
Sbjct: 12  VYVGNIAFHATEAELRDACELIGPVRSLRLAALDPATNKRKGYAFVEYADDET 64



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 12/58 (20%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLLK 425
           +VG ++   ++ E+R+     G +  + +   D   N+RKG+ F+ +  ++     L+
Sbjct: 13  YVGNIAFHATEAELRDACELIGPVRSLRLAALDPATNKRKGYAFVEYADDETARSALR 70


>06_01_0991 + 7704063-7704707
          Length = 214

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKT-DPNTGRSRGFAFIVFKAPES 168
           ++VG +++  T+ ELRD     G + S+ +   DP T + +G+AF+ +   E+
Sbjct: 12  VYVGNIAFHATEAELRDACELIGPVRSLRLAALDPATNKRKGYAFVEYADDET 64



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 12/58 (20%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP-FDKTKNQRKGFCFITFESEQVVNDLLK 425
           +VG ++   ++ E+R+     G +  + +   D   N+RKG+ F+ +  ++     L+
Sbjct: 13  YVGNIAFHATEAELRDACELIGPVRSLRLAALDPATNKRKGYAFVEYADDETARSALR 70


>05_04_0028 +
           17302359-17302445,17303887-17303952,17305415-17305489,
           17305638-17305737,17305819-17305865,17305937-17305994,
           17306161-17306210,17306417-17306473,17306561-17306703,
           17306793-17306834,17307083-17307124,17308239-17308272,
           17308342-17308443,17310373-17310652,17311202-17311332,
           17311676-17311773,17312525-17312717
          Length = 534

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAA 189
           ++VG L  +  ++E+ D F  YG I  I++K  P   R  G+AF+ F+ P ++ D +   
Sbjct: 9   IYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPP---RPPGYAFVEFEDPRDAQDAIYGR 65

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAVKS 282
             +  +  ++  + A    G      S+  S
Sbjct: 66  HGYDFDGHRLRVELAHGGRGPSFDRSSSYSS 96


>04_04_1188 +
           31579833-31579914,31580001-31580176,31580822-31580923,
           31581015-31581245,31581821-31581922,31582092-31582184,
           31582275-31582379,31582455-31582514,31582621-31582698,
           31582778-31582924,31583011-31583109,31583178-31583267,
           31583360-31583451,31583529-31583646,31583783-31583871,
           31583998-31584088,31584203-31584294,31584442-31584749,
           31584866-31584897
          Length = 728

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 27/101 (26%), Positives = 40/101 (39%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG L +    ++++  F   GE+  I   T  + G  RGF  + F   E+  K +   
Sbjct: 472 LFVGNLPYNVEQEQVKQFFQEAGEVVDIRFSTFED-GNFRGFGHVEFATAEAAKKALELA 530

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVN 315
            H +  + V    A+ R G          S   K   SS N
Sbjct: 531 GHDLMGRPVRLDLARER-GAYTPGSGRDNSSFKKPAQSSGN 570



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           L +HFG+ GEI  +++  D  TG S+G A++ F    S+ K
Sbjct: 590 LEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSK 630



 Score = 35.5 bits (78), Expect = 0.036
 Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 4/82 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRN----FFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           F+ G  + +   +IRN     F   G I  V +P D      KG  ++ F     ++   
Sbjct: 573 FIKGFDTSLDIHQIRNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSKAY 632

Query: 423 KTPKRTIGGKEVDVKRATPKPD 488
           +     +GG  + V  A P+PD
Sbjct: 633 ELNGSDLGGYSLYVDEARPRPD 654



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 16/68 (23%), Positives = 32/68 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L   +  ++++ FF E G ++++     +  N R GF  + F + +     L+   
Sbjct: 473 FVGNLPYNVEQEQVKQFFQEAGEVVDIRFSTFEDGNFR-GFGHVEFATAEAAKKALELAG 531

Query: 435 RTIGGKEV 458
             + G+ V
Sbjct: 532 HDLMGRPV 539


>03_03_0117 -
           14583102-14583186,14585202-14585336,14585440-14585604,
           14586168-14586245,14586796-14586941
          Length = 202

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L V  L  +    +LR  FG +G ++ I +  D  TG  RGF FI +  PE
Sbjct: 39  LLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPE 89



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT-FESEQVVNDLLKTPK 434
           V  L  +   D++R  F +FG + ++ +P D    + +GF FI  ++ E   +       
Sbjct: 41  VRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPEDAADAKYHMDG 100

Query: 435 RTIGGKEVDV 464
           + + G+EV V
Sbjct: 101 QILLGREVTV 110


>05_01_0290 +
           2270749-2271037,2272227-2272363,2272660-2272805,
           2272853-2272877
          Length = 198

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 15/60 (25%), Positives = 29/60 (48%)
 Frame = +3

Query: 246 WEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           W   V G+  E  +D++ N F +FG +  + +  D+     KG+  I +E+ +     +K
Sbjct: 101 WIVLVTGVHEEAQEDDLHNIFRDFGQVKNLHLNLDRRTGFVKGYALIEYETFEEAQAAIK 160


>02_04_0661 -
           24802868-24802921,24803004-24803089,24803178-24803274,
           24803378-24803475,24804705-24804882,24805485-24805676
          Length = 234

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 25/78 (32%), Positives = 33/78 (42%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +LF G L  E  D  L   F  Y       V  D  TG++RG+AF+ F         +AA
Sbjct: 127 RLFCGDLGNEVNDDVLTKAFSKYPSFNMARVIRDKWTGKTRGYAFVSFANASD----LAA 182

Query: 190 GEHTINNKKVDPKKAKAR 243
               +N K V  +  K R
Sbjct: 183 ALKEMNGKYVGNRPIKLR 200


>03_02_0555 +
           9431451-9431688,9432685-9432803,9432886-9433079,
           9433174-9433430,9433544-9433650,9433715-9433888,
           9434359-9434490,9434776-9434955,9435062-9435265
          Length = 534

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +++  ++ E  D  LR+ F  +G I S  +  D   G S+GF F+ +  PE
Sbjct: 309 VYIKNINDEVGDDALRERFNEFGNITSAKIMRDEK-GISKGFGFVCYNTPE 358



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           ++  ++ E+ DD +R  F+EFG I   ++  D+ K   KGF F+ + + E+    +  TP
Sbjct: 310 YIKNINDEVGDDALRERFNEFGNITSAKIMRDE-KGISKGFGFVCYNTPEEAKCAMRNTP 368

Query: 432 KR 437
           ++
Sbjct: 369 RQ 370



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 6/113 (5%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           ++  L++  L  + T++ ++  F  YG + S+ +    + G S+GF F+ F+ PES  + 
Sbjct: 202 KYTNLYMKNLDDDITEELIKLKFSQYGLVISVKIMKRDD-GTSKGFGFVSFQNPESAKRA 260

Query: 181 ------MAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSETSSVNLE 321
                 M  G  T+   +   K  + ++ + L E+      + KS  S+V ++
Sbjct: 261 KESMNGMLLGSKTLYVARAQKKAERKQYLQRLHEEKR-NEIITKSNGSNVYIK 312


>08_02_1039 -
           23866743-23866862,23866985-23867266,23867868-23867966,
           23868595-23868903
          Length = 269

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINV---KTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +FVG L+W    + LR+ F +   ++S+ V    T P   RS G+ F+ F + E+ +  +
Sbjct: 167 VFVGNLTWRVRSRHLRELFASTPGVQSVEVVFHTTSPR--RSAGYGFVSFSSKEAAEAAI 224

Query: 184 A 186
           +
Sbjct: 225 S 225


>07_03_0600 + 19866757-19867218,19867920-19868429
          Length = 323

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG L+ + TD  L + F  +Y  +    V  D  TGRS+G+ F+ F
Sbjct: 225 IFVGDLASDVTDSMLEEAFKTSYPSVRGAKVVFDKVTGRSKGYGFVRF 272



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFF-SEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           FVG L+S+++D  +   F + + ++   ++ FDK   + KG+ F+ F  E
Sbjct: 226 FVGDLASDVTDSMLEEAFKTSYPSVRGAKVVFDKVTGRSKGYGFVRFGDE 275


>03_04_0091 +
           17241555-17241602,17241685-17241822,17241901-17242198,
           17242281-17242513,17242632-17242827,17242911-17243032,
           17243100-17243165,17243373-17243436,17243851-17244176
          Length = 496

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  L   ++   +   F +FG I    +     K  R  F FI FES+Q +   ++   
Sbjct: 311 FVKSLPHNVTVQTVEEEFKKFGAIKPGGIQVRNNKIDRFCFGFIEFESQQSMQAAIEASP 370

Query: 435 RTIGGKEVDV--KRATPK 482
             +GGKEV V  KR T +
Sbjct: 371 IHMGGKEVFVEEKRTTTR 388


>08_01_0600 -
           5262573-5262773,5262850-5262952,5263050-5263180,
           5263263-5263312,5265266-5265725,5266349-5266708
          Length = 434

 Score = 35.9 bits (79), Expect = 0.027
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGL   ++DD ++  F+ +G ++ V++P  K    R G  F+ F +    ++ L   +
Sbjct: 292 FVGGLDPSVTDDMLKQVFTPYGDVVHVKIPVGK----RCG--FVQFANRASADEALVLLQ 345

Query: 435 RT-IGGKEV 458
            T IGG+ V
Sbjct: 346 GTLIGGQNV 354



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 15/57 (26%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L++G L +   +  +   F   GE++S+ +  D  TG+ +G+ FI F +    ++V+
Sbjct: 97  LWIGDLQYWMDENYISACFAPTGELQSVKLIRDKQTGQLQGYGFIEFTSHAGAERVL 153



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 123
           +FVGGL    TD  L+  F  YG++  + +      G
Sbjct: 291 IFVGGLDPSVTDDMLKQVFTPYGDVVHVKIPVGKRCG 327


>12_02_0849 -
           23640091-23640279,23640537-23640677,23640756-23642203,
           23642300-23642372,23642452-23642572,23642689-23642791,
           23642979-23643052,23643140-23643285,23643368-23643476,
           23643580-23643704,23643989-23644342,23644440-23644503,
           23644581-23645032
          Length = 1132

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 4/82 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGA-YGEIES---INVKTDPNTGRSRGFAFIVFKAPESIDK 177
           K+FVGGL      + L + F A +G +E    I ++      +SRGF F+ FK  E +  
Sbjct: 528 KIFVGGLPPSVGAEYLTEFFTAEFGPVEEAVVIGIRMGDRV-QSRGFGFVKFKREEDVIS 586

Query: 178 VMAAGEHTINNKKVDPKKAKAR 243
                   +  K+V+ K A AR
Sbjct: 587 AKETHHVYMLGKRVEVKDAVAR 608


>11_08_0081 -
           28216179-28216381,28216590-28216657,28217131-28217298,
           28217370-28217436,28217509-28217576,28218256-28218420,
           28218490-28218556,28218629-28218696,28219855-28219992,
           28220189-28220353,28221227-28221304,28221380-28221532,
           28222753-28222823,28223077-28223203,28223306-28223565,
           28223679-28223842,28224287-28224450,28225873-28226159
          Length = 826

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF- 392
           ++ KEG + +   FV  L      ++++  F +FG + +V +P D    + +GF F+ F 
Sbjct: 389 AKDKEGAAVSL--FVSNLPRSCRPEDVQVPFQKFGPVRDVYLPKDYNTGEPRGFAFVEFA 446

Query: 393 ESEQVVNDLLKTPKRTIGGKEVDV 464
            S           ++ + G+E+ V
Sbjct: 447 HSSDASKARYHMNRKMLSGREISV 470



 Score = 35.5 bits (78), Expect = 0.036
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           LFV  L      ++++  F  +G +  + +  D NTG  RGFAF+ F
Sbjct: 399 LFVSNLPRSCRPEDVQVPFQKFGPVRDVYLPKDYNTGEPRGFAFVEF 445


>05_01_0148 -
           985745-986180,986290-986385,986498-986694,986824-986919,
           987020-987059,987751-987857
          Length = 323

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           +L+VG LS  T  ++L  HF  YG I  + +K D        +AFI F  P   ++
Sbjct: 12  RLYVGRLSSRTRSRDLEYHFSRYGRIREVELKRD--------YAFIEFSDPRDAEE 59



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL-LKTP 431
           +VG LSS     ++   FS +G I EVE+        ++ + FI F   +   +      
Sbjct: 14  YVGRLSSRTRSRDLEYHFSRYGRIREVEL--------KRDYAFIEFSDPRDAEEARYNLD 65

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
            R + G  + V+ A   P GPG
Sbjct: 66  GRDVDGSRILVEFAKGVPRGPG 87


>11_06_0326 - 22382001-22383248
          Length = 415

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 3/77 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV GL        +   FS FG + E ++   +     KGF F+TF+S       L+   
Sbjct: 91  FVHGLPPHADAPALAAAFSRFGPLAECDVVARRATGACKGFGFVTFQSRAAARRALREVG 150

Query: 435 R---TIGGKEVDVKRAT 476
           R    + G+ V  + AT
Sbjct: 151 RGGVAVAGRAVSAQYAT 167



 Score = 35.1 bits (77), Expect = 0.047
 Identities = 17/58 (29%), Positives = 31/58 (53%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +++V  ++   + + LR  F  +GE+E      D +TG SRG A  V++A E   + +
Sbjct: 180 RVYVTNVAPGASAERLRAFFAGFGELEGGPFGFDADTGSSRGCALFVYRAAEDARRAL 237


>10_08_0154 +
           15266430-15266953,15267748-15267820,15267893-15267949,
           15268248-15268303,15269584-15269797,15270497-15270538,
           15270661-15270735,15270820-15270903,15271880-15271944,
           15272436-15272655,15272820-15272908,15273326-15273440,
           15273519-15273554
          Length = 549

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 13/38 (34%), Positives = 25/38 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQR 368
           +VG L S I++D++R  F  FG +  V++PF + ++ +
Sbjct: 293 YVGNLHSNITEDQLRQVFEPFGQVELVQLPFARLEDAK 330


>09_04_0716 +
           19702100-19702250,19702366-19702463,19702527-19702611,
           19702950-19703020,19703119-19703209,19703292-19703367,
           19704047-19704584
          Length = 369

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 11/75 (14%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELR-----------DHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 159
           +FVG LS  T D+ LR                YG ++S+ +  D  TG SRG+AF+ ++ 
Sbjct: 67  VFVGRLSRYTDDETLRKLLFLVVYVREQEMSRYGRVKSMRLVRDIVTGASRGYAFVEYET 126

Query: 160 PESIDKVMAAGEHTI 204
              + +      H+I
Sbjct: 127 DREMRRAYEDAHHSI 141


>08_02_1098 - 24291138-24291851,24292607-24292861
          Length = 322

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESIN---VKTDPNTG-RSRGFAFIVFKAPESIDK 177
           ++FV GL+  T + +L  HF  YG ++ ++   V+ D  TG  +  FA + F  PE    
Sbjct: 13  RVFVRGLAAGTGEADLLRHFDRYGVVDEVSIPGVEADTLTGLPALRFAIVKFGHPEFAGL 72

Query: 178 VMAAGEHTINNKKV 219
            +A  E  I+ + V
Sbjct: 73  ALADREQVIDGQTV 86


>04_04_0979 -
           29862280-29862444,29862718-29862999,29863831-29863929,
           29864037-29864366
          Length = 291

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           RH KL+V  L W+     +++ F  +  + S  V  D  +G+S G+ F+ F   E  +  
Sbjct: 173 RH-KLYVSNLPWKARAPNMKEFFSKFNPL-SAKVVFDSPSGKSAGYGFVSFGTKEEAEAA 230

Query: 181 M 183
           +
Sbjct: 231 L 231



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 14/55 (25%), Positives = 24/55 (43%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           +  KL+V  + W     E+   F   G ++ + V      G+ +GFAF+     E
Sbjct: 78  KRRKLYVANIPWSFPAPEIEKLFAQCGAVKDVEV-IKGKDGKKKGFAFVTMATAE 131


>02_02_0387 - 9606744-9607475
          Length = 243

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 13/50 (26%), Positives = 30/50 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           + G LS ++    +R  +SE G +++  + +DK + + +GF F+T  +++
Sbjct: 141 YAGDLSPQVDRLRLREMYSEHGKVVQARVVYDK-RGRSRGFGFVTMATQE 189



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/61 (27%), Positives = 29/61 (47%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  +++ G LS +     LR+ +  +G++    V  D   GRSRGF F+     E   + 
Sbjct: 136 RELRIYAGDLSPQVDRLRLREMYSEHGKVVQARVVYDKR-GRSRGFGFVTMATQEGFYRA 194

Query: 181 M 183
           +
Sbjct: 195 L 195


>01_07_0248 + 42261373-42261609,42261733-42261905,42261986-42262058,
            42262148-42262282,42262352-42262562,42262886-42263034,
            42263169-42263267,42263821-42263989,42264176-42264308,
            42264600-42264694,42264774-42264882,42265136-42265295,
            42265433-42265594,42265814-42265985,42266254-42266402,
            42266914-42266951,42267779-42267839,42267913-42268155,
            42268233-42268315,42269521-42269609,42270449-42270495,
            42270576-42270656,42270737-42270899,42271077-42271267,
            42271691-42271762
          Length = 1097

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 15/57 (26%), Positives = 28/57 (49%)
 Frame = +1

Query: 13   LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
            L +  LS    +  L++ FG +GE+ ++ +  D      RG+ +I FK     +K +
Sbjct: 895  LHIDHLSRNVNEAHLKEIFGNFGEVVNVELSMDRMVNLPRGYGYIEFKKRTDAEKAL 951


>07_03_1654 -
           28416487-28416548,28416791-28416824,28418156-28418212,
           28418401-28418450,28418968-28419025,28419136-28419182,
           28419278-28419377,28419446-28419586,28419715-28419780,
           28420024-28420118,28420440-28420629
          Length = 299

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 147
           ++VG L  +  ++E+ D F  YG I  I++K  P   R  GFAF+
Sbjct: 75  IYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPP---RPPGFAFV 116


>09_04_0736 -
           19815427-19815642,19815782-19816903,19817006-19817707,
           19817808-19817855,19817959-19818201,19819035-19819391
          Length = 895

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 3/89 (3%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           +RP       W   VGG+SS IS +E+   F +FG +  +    D+T        +I F+
Sbjct: 117 ARPARAVKNLW---VGGISSSISKEELEEEFKKFGKVDGIAFSRDQTS------AYIDFD 167

Query: 396 S-EQVVNDLLKTPKRTIGGKE--VDVKRA 473
             E  ++       R +GG+E  VD +R+
Sbjct: 168 KLEDAISAHRALNGRVLGGQELCVDFQRS 196


>04_01_0107 -
           1107976-1108033,1108411-1108638,1110109-1110422,
           1110568-1110680,1111740-1111845
          Length = 272

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +FVG L ++T   EL   F  YG I+ I++K+        GFAF+ F+     D+ + A
Sbjct: 4   VFVGNLDYDTRHSELDRLFYRYGRIDRIDMKS--------GFAFVYFEDERDGDEAIRA 54


>01_01_0386 -
           2985563-2985986,2986301-2986390,2986529-2986668,
           2986798-2986893,2987003-2987042,2987760-2987887
          Length = 305

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           +L+VG LS  T  ++L D FG YG +  +++K +        FAF+ F      D+
Sbjct: 19  RLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHE--------FAFVEFSDARDADE 66


>04_04_0946 - 29579779-29580004,29580098-29580210
          Length = 112

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +3

Query: 105 DRSKHRQITRVCLHCV*GPRVNRQGHGCW*THHQQQESRP 224
           DR+KHR+  R   H V   + +R  H     HHQQ + RP
Sbjct: 56  DRAKHRRKKRAAAHAVSVRKEHRNHHHHHRHHHQQPQPRP 95


>04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066
          Length = 646

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 18/59 (30%), Positives = 28/59 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           L++G L     D  L   F  +GEI    V  D  TG+S+G+ F+ +      +  +AA
Sbjct: 309 LYIGYLPPTLDDSGLIGLFSQFGEIVMAKVIRDRITGQSKGYGFVKYSDVSQANAAIAA 367



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 14/53 (26%), Positives = 26/53 (49%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN 413
           ++G L   + D  +   FS+FG I+  ++  D+   Q KG+ F+ +      N
Sbjct: 310 YIGYLPPTLDDSGLIGLFSQFGEIVMAKVIRDRITGQSKGYGFVKYSDVSQAN 362


>10_01_0076 -
           987092-987671,987747-987812,988201-988363,988467-988548,
           989153-989202,989237-989270,990177-990239,990339-990403,
           990485-990560,991274-991353,991514-991628,991729-991830
          Length = 491

 Score = 27.9 bits (59), Expect(2) = 0.27
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIE 90
           ++ LFV  L++ET++  ++  F AYG I+
Sbjct: 138 YKTLFVARLNYETSEHRVKREFEAYGPIK 166



 Score = 23.4 bits (48), Expect(2) = 0.27
 Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +1

Query: 94  INVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKV 219
           + + TD  T + RG+AFI +     + +    A    ++N++V
Sbjct: 196 VRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQADGRKVDNRRV 238


>12_02_0871 +
           23865343-23866016,23866122-23866170,23866276-23866356,
           23866599-23866718,23866957-23867055,23867135-23867194,
           23867316-23867410,23867483-23867508,23869212-23869285,
           23870194-23870259,23871027-23871099,23871585-23871622,
           23873758-23873871,23876079-23876195,23876288-23876368,
           23876468-23876536,23876631-23876669,23876809-23876973,
           23877380-23877484,23877569-23877637,23877754-23877816,
           23877903-23878021,23878124-23878348,23878409-23878610
          Length = 940

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN 117
           ++FVGGL    T++ LR+ F   GEI  + +  D N
Sbjct: 409 EVFVGGLPRSVTERALREVFSPCGEIVDLRIMKDQN 444


>07_03_1347 +
           25932185-25932748,25933151-25933755,25935797-25936214,
           25936433-25936555,25936775-25936989,25937157-25937412,
           25937844-25938149,25938764-25938820,25939635-25939685
          Length = 864

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 14/47 (29%), Positives = 27/47 (57%)
 Frame = +3

Query: 261 GGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           GG++S IS   + +FF+ +G ++   +  D T+ +R G    + ES+
Sbjct: 463 GGVASIISPVHLESFFTRYGVVIATVLLRDATRCERVGMLVFSAESD 509


>05_01_0041 +
           281427-281549,281671-281730,281822-281868,282013-282089,
           285368-285440,286193-286281,286665-286711,286805-286885,
           287011-287179,287381-287600,287679-287744,288194-288310,
           288591-288628,288935-289032
          Length = 434

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L V  LS    +  L++ F  YGE+ ++ +  D      RG+ ++ FK     +K +
Sbjct: 138 LHVDHLSRNVNEDHLKEIFENYGEVVNVELSMDRVVNLPRGYGYVEFKNRADAEKAL 194


>02_02_0284 -
           8547126-8547187,8547306-8547395,8547810-8547861,
           8548209-8548284,8550513-8550632,8553334-8553423,
           8553842-8554024,8554125-8554185,8554437-8554477,
           8554563-8554727,8555699-8555776,8556137-8556282
          Length = 387

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           L V  +      ++LR  F  +G +  + +  D  TG  RGFAF+ F  P
Sbjct: 39  LLVRNIPLSCRAEDLRVPFERFGPVRDVYLPKDYYTGEPRGFAFVEFVDP 88



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +3

Query: 288 DEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL-LKTPKRTIGGKEVDV 464
           +++R  F  FG + +V +P D    + +GF F+ F      ++      ++ + G+E+ V
Sbjct: 51  EDLRVPFERFGPVRDVYLPKDYYTGEPRGFAFVEFVDPYDASEAQYHMNRQVVFGREITV 110

Query: 465 KRATPKPDGP 494
             A      P
Sbjct: 111 VLAAESRKRP 120


>04_04_1641 +
           34993807-34994589,34994924-34995022,34995521-34995648,
           34996095-34996235,34996456-34996542,34996627-34996780,
           34998569-34998628,34999019-34999447,34999524-34999819,
           35000278-35000407,35000690-35001187
          Length = 934

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRK-GFCF 383
           + E+R +E      + FVG L       EI  FF +FG + +VE+       +R  GFCF
Sbjct: 107 EAEARRQEEFRHKGKVFVGNLPLWARKAEIAEFFRQFGPLEKVELVRGHDDPERNVGFCF 166

Query: 384 ITF 392
           + +
Sbjct: 167 LYY 169


>03_03_0042 +
           14009649-14009866,14011342-14011419,14011791-14011955,
           14012071-14012138,14012219-14012258,14013579-14013690,
           14013859-14013942
          Length = 254

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTPK 434
           V  +S     ++IR  F +FG + +V +P +    + +GF F+ F   E       +   
Sbjct: 65  VRNISLTARPEDIRIPFEQFGPVKDVYLPRNFHTRELRGFGFVKFRYPEDAAVAKQELNH 124

Query: 435 RTIGGKEVDV 464
           + IGG+E+ +
Sbjct: 125 QVIGGREISI 134



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 14/51 (27%), Positives = 27/51 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           L V  +S     +++R  F  +G ++ + +  + +T   RGF F+ F+ PE
Sbjct: 63  LLVRNISLTARPEDIRIPFEQFGPVKDVYLPRNFHTRELRGFGFVKFRYPE 113


>02_05_1020 -
           33561454-33561568,33561839-33562070,33563286-33563374,
           33563856-33563944
          Length = 174

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           +L+VG L    T  EL D F  +G + S+ V   P      GFAFI F
Sbjct: 3   RLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKP-----PGFAFIDF 45



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           +VG L   ++  E+ + F  FG +  V +       +  GF FI F+ ++   D L+
Sbjct: 5   YVGNLDPRVTSGELEDEFRVFGVLRSVWV-----ARKPPGFAFIDFDDKRDAEDALR 56


>01_06_1531 +
           38024757-38024790,38025592-38025803,38026111-38026248,
           38026405-38026449,38026499-38026591,38028072-38028815
          Length = 421

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 11/51 (21%), Positives = 30/51 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           ++G L  ++++  +     + G ++++ +P DK  +  KG+ F  +E+E++
Sbjct: 10  YIGNLDEKVTERILYEILIQPGRVVDLCIPRDKETSCPKGYAFAEYETEEI 60


>10_02_0023 +
           4306350-4306908,4308429-4308814,4308917-4308991,
           4309330-4309539,4309649-4309961,4310035-4310130,
           4310220-4310357,4310436-4310536,4310645-4310712,
           4310800-4310849,4311790-4311848,4312399-4312530
          Length = 728

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 2/86 (2%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           +G   T E FVGGL  +  +++IR  FS+ G +  +     +   +RK   F+ +     
Sbjct: 248 DGNDKTLELFVGGLPKDCVEEDIRVVFSQCGEVESI-----RIVKKRKRIAFVRYADISA 302

Query: 408 VNDLLKTPKR--TIGGKEVDVKRATP 479
               L   K    + GK V V  A P
Sbjct: 303 TKKALTEFKDGIKVNGKSVRVSVAEP 328



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINV 102
           +LFVGGL  +  ++++R  F   GE+ESI +
Sbjct: 255 ELFVGGLPKDCVEEDIRVVFSQCGEVESIRI 285


>07_03_1709 -
           28873172-28873327,28873519-28873584,28874067-28874127,
           28875406-28875462,28876301-28876531,28876685-28876799,
           28876897-28877136,28877222-28877316,28877406-28877585,
           28877663-28877839,28877920-28878890
          Length = 782

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +1

Query: 46  DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVD 222
           ++++ ++F  YG +  + +       + R F F+ F  PE++  ++A G  H I + +V 
Sbjct: 375 EEDVSNYFSIYGPVHDVRIPYQ----QKRMFGFVTFVYPETVKLILAKGNPHFICDARVL 430

Query: 223 PKKAKARHGKI 255
            K  K + GK+
Sbjct: 431 VKPYKEK-GKV 440


>06_01_0613 +
           4439829-4439917,4440650-4440738,4441219-4441453,
           4441768-4441771,4441829-4441930
          Length = 172

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           +++VG L    T +EL D F  +G + S+ V   P      GFAFI F
Sbjct: 3   RVYVGNLDPRVTARELEDEFRVFGVLRSVWVARKP-----PGFAFIDF 45


>03_02_0874 +
           12017069-12018051,12018137-12018316,12018421-12018600,
           12018718-12018797,12018999-12019259,12019360-12019474,
           12019631-12019855,12020840-12020849
          Length = 677

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +1

Query: 46  DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVD 222
           ++++ ++F  YG +  + +       + R F F+ F  PE++  ++A G  H I + +V 
Sbjct: 380 EEDVSNYFSIYGPVHDVRIPYQ----QKRMFGFVTFVYPETVKLILAKGNPHFICDARVL 435

Query: 223 PKKAKARHGKI 255
            K  K + GK+
Sbjct: 436 VKPYKEK-GKV 445


>12_02_0846 -
           23623624-23623784,23624076-23624258,23624601-23624641,
           23624746-23624910,23625808-23625885,23626024-23626169
          Length = 257

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           L V  +      ++LR  F  +G +  + +  D  +G  RGFAF+ F  P
Sbjct: 39  LLVRNIPLSCRGEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEFVDP 88



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +3

Query: 288 DEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           +++R  F  FG + +V +P D    + +GF F+ F
Sbjct: 51  EDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVEF 85


>07_01_0284 - 2082249-2082256,2082496-2083009
          Length = 173

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +1

Query: 10  KLFVGGLSWE-TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           +LFV G+S + TT+ +LR HF  YG +  I ++      R  G+AF+  + P
Sbjct: 108 RLFVFGVSKKRTTELDLRRHFKRYGYVADIWLR------RRGGYAFVQLRTP 153


>08_02_1176 +
           24931728-24931877,24933175-24933275,24934410-24934788,
           24935509-24936354,24936555-24936642,24936947-24937039,
           24937221-24937318,24937364-24937470,24938266-24938353,
           24938748-24939005
          Length = 735

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = +1

Query: 43  TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           T   L  HF  +G +  + + T+  TG+  G A++ F   ES ++ ++
Sbjct: 591 TKDALSRHFNKFGAVLKVVIVTNAATGQPTGSAYVEFLHKESAERALS 638


>03_05_0066 -
           20455976-20456161,20456251-20456347,20456608-20456738,
           20456814-20456869,20457498-20457543
          Length = 171

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 123
           +FVGGL    TD+ L+  F  YGE+  + +      G
Sbjct: 35  VFVGGLDPSVTDEVLKQAFSPYGELVYVKIPVGKRCG 71


>02_04_0577 -
           24011542-24011906,24012285-24012385,24013029-24013287,
           24014176-24014264,24015331-24015419
          Length = 300

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           +++VG L    T +E+ D F  +G + S+ V   P      GFAFI F
Sbjct: 3   RVYVGNLDPRVTAREIEDEFRVFGVLRSVWVARKP-----PGFAFIDF 45


>05_01_0455 -
           3614011-3614503,3615007-3615072,3615154-3615347,
           3615562-3615657,3615790-3615829,3616729-3616856
          Length = 338

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 11/37 (29%), Positives = 23/37 (62%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTD 111
           R+ +L+VG +S  T  ++L + F  YG +  +++K +
Sbjct: 16  RNSRLYVGHISLRTRAEDLENLFSRYGRVRFVDLKNE 52


>02_01_0598 +
           4440018-4440070,4440627-4440693,4440794-4440926,
           4441075-4441120,4442470-4442521,4442601-4442753,
           4443338-4443457,4443549-4443714,4443822-4443934,
           4444049-4444120,4444992-4445213,4445270-4445317,
           4445639-4445697,4445809-4445887,4445982-4446119,
           4446327-4446551,4446643-4447430,4447548-4447723,
           4447911-4448169,4448646-4448707,4451055-4451212,
           4451618-4451743,4452197-4452260,4452386-4452494,
           4452607-4452760,4453055-4453178,4453257-4453333,
           4453442-4453494,4453673-4453727,4453833-4454021
          Length = 1379

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/48 (27%), Positives = 27/48 (56%)
 Frame = +3

Query: 228 EG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRK 371
           +G   T   +VG LS ++ ++ +   F  FG I  V++ + +T+ +R+
Sbjct: 192 DGDPQTTNLYVGNLSPKVDENFLMRTFGRFGPIASVKIMWPRTEEERR 239


>10_08_0747 - 20272157-20272456,20272538-20272664,20272770-20272843,
            20272928-20272971,20273697-20276223
          Length = 1023

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +1

Query: 10   KLFVGGLSWETTDKELRDHFGAYGEI--ESINVKT-DPNTGRSRGFAFIVFKAPE 165
            +L+VG L +  ++ ++   F  +G+I  E     T  P  G  RG+AF+ +   E
Sbjct: 870  RLYVGNLDFRVSESDIIKMFSPFGKIIAEDFLWHTRGPKRGEPRGYAFVQYTTKE 924


>10_07_0126 - 13143485-13144117,13144204-13145238
          Length = 555

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
 Frame = -1

Query: 236 LAFFGSTFLLLMVCSPAAMTLSIDSGALN-TMKANPRDLPVFGSVFTL 96
           L  F +  +L    SP     +   G L  T    PR LPVFGS+F L
Sbjct: 42  LLAFATAAVLAWAASPGGPAWAHGRGRLGATPIEGPRGLPVFGSIFAL 89


>07_03_1711 +
           28909297-28909329,28909725-28910204,28910300-28910428,
           28910511-28910567,28910669-28910761,28911278-28911483,
           28912757-28912898,28912981-28913170,28913263-28913369
          Length = 478

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -3

Query: 267 VLRQNLPMSCFSLLWVYFLVVDGVFTSSH 181
           V + N+P  C  L++ Y L+VDG    SH
Sbjct: 420 VQKDNIPYICMDLVYQYTLLVDGFGVGSH 448


>07_03_1651 -
           28395369-28395436,28395524-28395575,28395857-28396092,
           28396362-28396419,28396509-28396577,28396686-28396791,
           28397104-28397171,28397266-28397385,28398144-28398231,
           28399433-28399534,28399699-28399757,28399866-28400003,
           28400222-28400473,28400508-28400593,28401061-28401165,
           28402351-28402516
          Length = 590

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/79 (20%), Positives = 35/79 (44%)
 Frame = +1

Query: 124 RSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSET 303
           + + FA   +     + K +   + + + +KVD  +  A    +L  D   +++++ +  
Sbjct: 377 KGKRFAKKRYAEKAQMKKTLKMHDESTSRQKVDDVQEGALPPYLLDRDQTQRAKVLSNTI 436

Query: 304 SSVNLELS*KWRCPLTKQR 360
               +E + KW  PL K R
Sbjct: 437 KQKRMEKAGKWEVPLPKVR 455


>02_05_0544 +
           29876337-29876524,29876850-29876882,29878390-29878577,
           29879755-29879811,29879909-29880061,29880812-29881278,
           29881477-29881635,29881718-29881834,29881966-29882117,
           29883436-29883530,29883619-29884525,29884604-29884688,
           29884775-29884843,29885045-29885224,29885367-29885495
          Length = 992

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/73 (24%), Positives = 34/73 (46%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L +  L    +++E+R  FG YGE++ I  +  PN    +   F   +A E+  + +   
Sbjct: 428 LVIFNLDPSVSNEEVRQIFGTYGEVKEI--RETPNKKHHKFIEFYDVRAAEAALRSLNKS 485

Query: 193 EHTINNKKVDPKK 231
           E      K++P +
Sbjct: 486 EIAGKRIKLEPSR 498



 Score = 27.5 bits (58), Expect = 9.4
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           LFV  ++    D ELR  F  YG+I ++   T     + RGF  I +
Sbjct: 343 LFVRNINSNVDDTELRSLFEQYGDIRTLYTAT-----KHRGFVMISY 384


>02_01_0304 +
           2037718-2037939,2038169-2038384,2038862-2039329,
           2039419-2040171
          Length = 552

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESIN-VKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           ++FVGG+S      +L   F + G +  +  V+T+   GRS  FA++ F  P   DK +A
Sbjct: 17  RIFVGGISEGVAAADLEAMFASVGRVAGVEFVRTN---GRS--FAYVDFHCPS--DKALA 69

Query: 187 AGEHTINNKKVDPKKAKARHGK 252
               T N  K    K +    K
Sbjct: 70  KLFSTYNGCKWKGGKLRLEKAK 91


>08_01_0181 +
           1530623-1531626,1531723-1531902,1531998-1532177,
           1532363-1532442,1532528-1532701,1533001-1533118,
           1533223-1533301
          Length = 604

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +1

Query: 46  DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV-MAAGEHTINNKKV 219
           + ++ ++FG YG +  + +         R F F+ F++PE++  + M    H I   +V
Sbjct: 387 EDDVANYFGQYGPVRDVRIPCQER----RMFGFVSFQSPETVSTILMRRNPHFICGSRV 441


>07_03_1389 +
           26212117-26212119,26212721-26212875,26213402-26213479,
           26214211-26214375,26214453-26214554,26214661-26214786,
           26215454-26215490
          Length = 221

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT-FESEQVVNDLLKTPK 434
           V  L  +   +++R  F +FG + ++ +P D    + +GF F+  ++ +   +       
Sbjct: 45  VRNLRRDCRPEDLRRPFGQFGRLKDIYIPRDYYSGEPRGFGFVQYYDPDDAADAKYYMDG 104

Query: 435 RTIGGKEVDV 464
           + I G+EV V
Sbjct: 105 QVILGREVAV 114


>03_05_0905 -
           28665838-28666422,28667073-28667156,28667335-28667410,
           28667497-28667600,28668673-28668735,28669312-28669317
          Length = 305

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  +S   S  EI  FFS  G I  VEM   +++++R    ++TF+  Q  +  +     
Sbjct: 29  VSNISLNASKREITEFFSFSGDIEYVEM---QSESERSQLAYVTFKDSQGADTAVLLSGA 85

Query: 438 TIGGKEV 458
           TI  + V
Sbjct: 86  TIVDRSV 92


>06_03_1076 +
           27409107-27409204,27409731-27409835,27409915-27410032,
           27410180-27410230,27410328-27410419,27410558-27410657,
           27411018-27411137,27411227-27411295,27411468-27411514,
           27411597-27411652,27412293-27412333,27412570-27412675,
           27413891-27414023,27414096-27414645
          Length = 561

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = +3

Query: 285 DDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           D+++   FS FGT+   E+  D        + FI FE+++
Sbjct: 252 DEDLYTIFSRFGTVTSAEIIRDYKTGDSLCYAFIEFETKE 291


>04_04_1223 +
           31851545-31852609,31854314-31854773,31856201-31856250,
           31856333-31856463,31856569-31856665,31856759-31856950,
           31857121-31857123
          Length = 665

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 123
           +FVGGL    T+  L+  F  YGE+  + +      G
Sbjct: 526 IFVGGLDPNVTEDVLKQVFAPYGEVVHVKIPVGKRCG 562


>11_01_0002 + 3386-3541,3619-3717,4114-4182,4275-4459,4662-4677
          Length = 174

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/60 (26%), Positives = 30/60 (50%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           +  L   +S+++I+  FSE G +    + +DK+  + KG   + F  +   +D L   KR
Sbjct: 72  ISNLDYAVSNEDIKELFSEVGDVKRYSINYDKS-GRSKGTAEVVFSRK---SDALAAVKR 127


>08_01_0272 +
           2200061-2200078,2200835-2202076,2202201-2202698,
           2203316-2203345
          Length = 595

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = -3

Query: 234 SLLWVYFL--VVDGVFTSSHDLVY*LWGLKHNEGKP 133
           S  W YF+  V D + T  HD+++ +  L H E KP
Sbjct: 324 SSFWAYFMATVSDFLCTRCHDVIFSIVKLVHPESKP 359


>06_03_1075 +
           27399279-27399376,27399449-27399555,27400791-27400898,
           27401763-27401860,27401983-27402033,27402137-27402228,
           27402360-27402459,27402765-27402884,27402977-27403045,
           27403299-27403345,27403428-27403483,27404760-27404800,
           27405155-27405260,27406728-27406860,27406937-27407357
          Length = 548

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +3

Query: 285 DDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           D+++   FS FG++   E+  D        F FI FE ++
Sbjct: 282 DEDLYTIFSHFGSVTSAEIIRDYKTGDSLCFAFIEFEKKE 321


>03_02_0596 +
           9714022-9714065,9714799-9714868,9714978-9715883,
           9715973-9716146,9716260-9716373,9716975-9717033,
           9717170-9717236,9717305-9717356,9718070-9718488,
           9718786-9718847,9719305-9719374,9719730-9719831,
           9719933-9720063,9720492-9720606,9720792-9720827
          Length = 806

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
 Frame = +1

Query: 73  AYGEIESIN-VKTDPNTGRSRGFAFIVF--KAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           A GE + IN V  +    +    A  V   KAPE + +V    E  +N++  D +  K  
Sbjct: 132 ANGEADDINDVSANSENLKQESIANSVESDKAPEELKEVSGCSEELLNDENGDSEGLKDS 191

Query: 244 HGKI 255
           HG +
Sbjct: 192 HGAL 195


>01_06_1775 - 39808794-39808919,39809021-39809127,39810594-39812178
          Length = 605

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +1

Query: 94  INVKTDPNTGRSRGFAFIVF 153
           + +  D N+GRSRGF F+ F
Sbjct: 529 VRIMYDKNSGRSRGFGFVHF 548


>11_06_0289 - 21969248-21973516
          Length = 1422

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +Q++N+  +   R + G+E D  +AT +PD P
Sbjct: 592 KQMINEAKQDVLRELRGRETDKNQATGEPDVP 623


>11_06_0185 + 21018045-21022307
          Length = 1420

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 399 EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 494
           +Q++N+  +   R + G+E D  +AT +PD P
Sbjct: 590 KQMINEAKQDVLRELRGRETDKNQATGEPDVP 621


>04_04_1001 -
           30020380-30021045,30021127-30021210,30022091-30022166,
           30022241-30022353,30023678-30023683
          Length = 314

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 21/73 (28%), Positives = 34/73 (46%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  +S + S  +++ FFS  G I+ VEM   ++ ++     +ITF+  Q     +     
Sbjct: 11  VSNVSLKASLRDVKEFFSFSGDIVHVEM---QSSDELSQVAYITFKDNQGSETAMLLTGA 67

Query: 438 TIGGKEVDVKRAT 476
           TI    V V  AT
Sbjct: 68  TIVDMAVIVTPAT 80


>01_06_0952 - 33310262-33310273,33310468-33311142
          Length = 228

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -1

Query: 143 KANPRDLPVFGSVFTLILSISPYA 72
           +A+P +LP F  VF ++LS  P A
Sbjct: 141 RADPHNLPFFDGVFDVVLSDEPMA 164


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,096,939
Number of Sequences: 37544
Number of extensions: 291185
Number of successful extensions: 1146
Number of sequences better than 10.0: 183
Number of HSP's better than 10.0 without gapping: 893
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1129
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -