SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20080
         (709 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0382 - 5076673-5077774,5078122-5078186                           29   2.7  
02_04_0398 - 22598895-22599100,22599865-22599943                       28   8.4  

>04_01_0382 - 5076673-5077774,5078122-5078186
          Length = 388

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -1

Query: 130 DIAVVLFRSCVTIPGIFLKIYTFTIVLNKC 41
           D+A+ LF    T  GI    +TFT+VLN C
Sbjct: 132 DVALQLFEEMKTKYGIAPTAHTFTLVLNAC 161


>02_04_0398 - 22598895-22599100,22599865-22599943
          Length = 94

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 1/21 (4%)
 Frame = +3

Query: 273 GGSRESGCCSYVIHW-ECLSC 332
           GG    GCC +  HW ECL C
Sbjct: 73  GGHCRWGCCGHRNHWGECLRC 93


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,412,161
Number of Sequences: 37544
Number of extensions: 305437
Number of successful extensions: 578
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 567
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 577
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1827423340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -