SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0685 - 20679883-20679927,20680034-20680087,20680179-206803...    64   1e-10
05_05_0359 + 24393254-24393260,24393952-24394163,24394243-243942...    61   1e-09
04_04_1237 - 31991817-31992569,31993452-31993550,31994343-319949...    54   1e-07
01_06_0992 - 33644712-33644726,33644769-33644822,33644915-336451...    43   2e-04
07_01_1071 - 9525734-9525875,9526044-9526117                           30   2.0  
10_08_0077 + 14690894-14691030,14691258-14691936                       29   4.7  
04_04_1325 + 32666302-32667633                                         29   4.7  
01_06_1413 + 37149038-37149295,37149392-37149603,37149687-371499...    29   4.7  

>07_03_0685 -
           20679883-20679927,20680034-20680087,20680179-20680390,
           20680476-20680550,20683094-20683168,20686196-20686264,
           20686349-20686502,20686577-20686654,20689102-20689194,
           20689491-20689640,20690134-20690268,20691009-20691098,
           20691412-20691453,20691796-20692053,20692131-20692207,
           20693126-20693186,20693687-20693905,20694936-20695208,
           20695314-20695505,20695841-20696011
          Length = 840

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 25/43 (58%), Positives = 36/43 (83%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTVV+ PE G+V+QLQGDQR+N+  +L ++G+VK E +K+HGF
Sbjct: 798 GTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 840



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  E+   KI++  KKEF C
Sbjct: 770 SLTTVQGLKKEFSYNKILKDLKKEFCC 796



 Score = 35.1 bits (77), Expect = 0.054
 Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 3/42 (7%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDG---LVHVRIQQRNGRR 256
           + IQ    FDPFA+A  + +     G    VHVRIQQRNGR+
Sbjct: 729 LDIQIPTAFDPFAEA-NAGDSGAAAGSKDYVHVRIQQRNGRK 769


>05_05_0359 +
           24393254-24393260,24393952-24394163,24394243-24394296,
           24394400-24394444
          Length = 105

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 23/43 (53%), Positives = 35/43 (81%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTVV+ PE G+V+QLQGDQR+N+  +L ++G+ K + +K+HGF
Sbjct: 63  GTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKDNIKIHGF 105



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY   KI++  KKEF C
Sbjct: 35  SLTTVQGLKKEYSYNKILKDLKKEFCC 61



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 3/33 (9%)
 Frame = +2

Query: 167 DPFADAIKSSEDDVQDGL---VHVRIQQRNGRR 256
           DPFA+A  + +     G    VHVRIQQRNGR+
Sbjct: 3   DPFAEA-NAEDSGAGPGAKDYVHVRIQQRNGRK 34


>04_04_1237 -
           31991817-31992569,31993452-31993550,31994343-31994976,
           31995329-31995585
          Length = 580

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 21/43 (48%), Positives = 32/43 (74%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           G VVE  E G+++QLQGD R ++  +L K+G+V+ + +KVHGF
Sbjct: 538 GNVVEDKELGKIIQLQGDHRNSVSDFLAKAGMVRKDNIKVHGF 580



 Score = 35.9 bits (79), Expect = 0.031
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQG+  EY+  K++R  K+E  C
Sbjct: 510 TLTTVQGIGGEYNYAKVLRDLKRELCC 536


>01_06_0992 -
           33644712-33644726,33644769-33644822,33644915-33645126,
           33645436-33645472
          Length = 105

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/33 (51%), Positives = 25/33 (75%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLV 437
           GTVV+ PE G+V+QLQGDQR+N+  +L +   +
Sbjct: 73  GTVVQDPELGQVIQLQGDQRKNVATFLVQIAFI 105



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY   KI++  KKEF C
Sbjct: 45  SLTTVQGLKKEYSYNKILKDLKKEFCC 71



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDG---LVHVRIQQRNGRR 256
           + +Q  + FDPFA+A  + +  V  G    VHVRIQQRNGR+
Sbjct: 4   LDVQLPSAFDPFAEA-NAEDSSVGAGSKDYVHVRIQQRNGRK 44


>07_01_1071 - 9525734-9525875,9526044-9526117
          Length = 71

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -2

Query: 355 CSTTVPCTRTPSCM-PARSSSGHIPRKGLAP*SASTPVSLLDTD 227
           CS     +R PSC+  ARSS  +I R+   P +A+TP   L  D
Sbjct: 3   CSELHGPSRRPSCLLSARSSRRNIDRQRRHPAAAATPTESLTAD 46


>10_08_0077 + 14690894-14691030,14691258-14691936
          Length = 271

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = -2

Query: 379 CSTSP-YSGCSTTVPCTRTPSCMPARSSSGHIPRKGLAP*SASTPVSLLDTDVD 221
           CS+ P  S   TT   TR+PS +    S+  +PR+G     A T VS+  +D++
Sbjct: 46  CSSKPRISRSPTTSGTTRSPSGVTWSLSARSVPRRGRLTHLAETFVSVPPSDMN 99


>04_04_1325 + 32666302-32667633
          Length = 443

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = -2

Query: 508 MLSVDMLCFSRAA*KPCTLSCSGFTKPDLVSHWQIFSRWSP*SCSTSPYSGCSTTVPCTR 329
           +L V      RA  KPCT + +   +P++++ W++ +          P   C++  P   
Sbjct: 80  LLHVQEAAAKRAVIKPCTPTLTPPNEPEVINAWELMAGLE----DDPPTPPCASHEPPAV 135

Query: 328 TPSCMPA 308
           TP  M A
Sbjct: 136 TPQWMQA 142


>01_06_1413 +
           37149038-37149295,37149392-37149603,37149687-37149951,
           37150099-37150407
          Length = 347

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +1

Query: 91  VVSQRFVETKRPYVQSYVHPESQHI 165
           V +QR+V  K P+V+ + HPE  H+
Sbjct: 299 VEAQRYVAEKLPWVRYHEHPEGGHL 323


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,406,454
Number of Sequences: 37544
Number of extensions: 371802
Number of successful extensions: 1013
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 986
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1013
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -