SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0441 - 8517501-8517701,8518004-8518139,8519995-8520107,852...    47   1e-05
07_03_0997 - 23203166-23203330,23203627-23203693,23203771-232038...    37   0.012
11_01_0346 - 2589111-2589220,2589613-2589852,2589956-2590028,259...    28   5.4  

>03_02_0441 -
           8517501-8517701,8518004-8518139,8519995-8520107,
           8520189-8520284,8520376-8520590,8520675-8520797,
           8520887-8520917,8521020-8521079,8521951-8522106,
           8522185-8522274,8522347-8522562,8522671-8522805,
           8522898-8523401,8523485-8523700,8524411-8524456,
           8524542-8524678,8525059-8525191,8526084-8526358
          Length = 960

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/87 (29%), Positives = 46/87 (52%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L F+F C+ +   + +E  + +F+S+    G     +L+ ++ +L+  LQ   S  +R
Sbjct: 118 ELLPFIFQCSQSPQEDHREVALILFSSLTETIGTTFQSHLNDLQPILLKCLQDEASSRVR 177

Query: 435 TQAVKAVGAFILLHDKEPIIQKHFRMF 515
             A+KAVG+FI   +    + K FR F
Sbjct: 178 IAALKAVGSFIEYVNDGGDVVKIFRDF 204



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 23/84 (27%), Positives = 42/84 (50%)
 Frame = +1

Query: 4   HEIQNADIAEDVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLR 183
           H ++ A    +VRQ AAVLLR+  ++             +  L++ L+ ++ +D S  +R
Sbjct: 42  HHLRTAK-TPNVRQLAAVLLRKKITS----HWPKLPPHAKASLKQALIDSITIDHSHLVR 96

Query: 184 RKVCDVVSELARNHIDDDGNNQWP 255
           R   +VVS +A+  +      +WP
Sbjct: 97  RASANVVSIIAKYAVP---AGEWP 117


>07_03_0997 -
           23203166-23203330,23203627-23203693,23203771-23203862,
           23204820-23204956,23205050-23205116,23205212-23205278,
           23205356-23205441,23206061-23206153,23206337-23206522,
           23207316-23207372,23207455-23207582,23207662-23207731,
           23207815-23207950,23208378-23208529,23208606-23208680,
           23208765-23208929,23209063-23209128,23209229-23209333,
           23209929-23210132,23210462-23211715
          Length = 1123

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 9/70 (12%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFS---------AXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRR 186
           D+R  AAVLLR+L S         A             Q  L++ LL  LQ D  + + +
Sbjct: 70  DLRAMAAVLLRKLLSPTPSSDASSAAAAPVWPHLSPAGQAALKQHLLSALQSDPPKPIAK 129

Query: 187 KVCDVVSELA 216
           KVCD +SELA
Sbjct: 130 KVCDAISELA 139



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +3

Query: 252 AEFLQFMFTCASAQD-PNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMA 428
           AE L F+F  AS  + PN++E+ + +F  +         ++L  I  +L SAL    S  
Sbjct: 149 AELLPFLFRAASGPEAPNLQESALLIFARLADYIAESLLDHLMTIHNLLASALAHPTSPD 208

Query: 429 LRTQAVKA 452
           +R  A+ A
Sbjct: 209 VRIAALSA 216


>11_01_0346 -
           2589111-2589220,2589613-2589852,2589956-2590028,
           2590301-2590606,2590698-2590912,2591461-2591755,
           2591901-2592065,2592142-2592738,2593029-2593115,
           2593203-2593523,2594047-2596071
          Length = 1477

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = +2

Query: 251 GRVPTVHVYLCQCARSKHQRSWY 319
           G V  V ++ C+C  S  QR WY
Sbjct: 341 GIVLAVTIFFCKCCESLSQRQWY 363


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,126,793
Number of Sequences: 37544
Number of extensions: 349055
Number of successful extensions: 806
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 787
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 805
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1549385732
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -