SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_06_0156 - 26031463-26031572,26031961-26032039,26032133-260322...    31   1.1  
03_05_0640 - 26326832-26327166,26327295-26327529,26327665-263279...    31   1.1  
10_08_0506 + 18390892-18391373,18392699-18392798,18393152-183934...    29   2.5  
04_04_0298 + 24228569-24228763,24229792-24229900,24230001-242300...    29   3.3  
10_05_0092 - 9106725-9106769,9107172-9107367,9107525-9107898           29   4.3  
08_02_1416 - 26915306-26915459,26915553-26915668,26915798-269159...    29   4.3  
07_03_0605 + 19908541-19909605,19909703-19910092                       28   5.7  
03_02_0048 - 5265595-5265783,5265882-5265992,5266259-5266547,526...    28   5.7  
01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-33...    28   5.7  
10_06_0139 - 11139004-11139031,11139300-11141017,11141408-111414...    28   7.6  
02_01_0570 - 4195409-4195443,4196245-4196333,4196539-4196630,419...    28   7.6  

>05_06_0156 -
           26031463-26031572,26031961-26032039,26032133-26032261,
           26032362-26032559,26032741-26032900,26032980-26033147,
           26033290-26033405,26033491-26033586,26033675-26034058,
           26035150-26035572,26037202-26037315,26037969-26038017,
           26038103-26038262,26038345-26039014
          Length = 951

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/57 (31%), Positives = 27/57 (47%)
 Frame = +2

Query: 125 SNYGGGSICIRDCVSRGFTTTPHRRILGSRNAGAERQTDSSTR*VEMRVERLRKDTV 295
           S  GGG+  +R     G  TTP     GS   G++R +D     VE+ ++    DT+
Sbjct: 7   SGSGGGTTPVRPRWGSG-VTTPRSLSTGSSPRGSDRSSDDGEELVEVTLDLQEDDTI 62


>03_05_0640 -
           26326832-26327166,26327295-26327529,26327665-26327908,
           26328389-26328507,26328860-26329050,26329133-26329220,
           26331653-26331715,26331816-26333944,26334084-26334186
          Length = 1168

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 25/82 (30%), Positives = 37/82 (45%)
 Frame = +2

Query: 203 LGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECD 382
           L +  A A    D     VE R   L +D      E+DS +    S   SEL+ +IS+ +
Sbjct: 432 LSAATASAHEGVDLYCNFVETRPV-LMEDIGASAFEQDSKIQEAVSASDSELISEISDVE 490

Query: 383 KDDITRYADRILSRAMTVEVTV 448
           ++DIT   D I    +  E+ V
Sbjct: 491 QEDITDKGDVIDDGFLAEELNV 512


>10_08_0506 +
           18390892-18391373,18392699-18392798,18393152-18393485,
           18393756-18393868,18394437-18394565,18394746-18394839,
           18394942-18395025,18395265-18395896,18396662-18396951,
           18397098-18397242,18397876-18397973,18398075-18398156,
           18398607-18398612,18398845-18398928
          Length = 890

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = -1

Query: 267 RISTYLVLLSVCLSAPAFLEPRIRR*GVVVNPLDTQSLMQIDPPP 133
           R +++L LL +C SAP      +R  G+V   +D   ++ ID PP
Sbjct: 137 RRASFLALLGICASAPR--RRVLRAQGLVQQIIDAILVLNIDDPP 179


>04_04_0298 +
           24228569-24228763,24229792-24229900,24230001-24230069,
           24230159-24230262,24230361-24230490,24231270-24231374,
           24231479-24231689,24231917-24231927,24232331-24232341,
           24233863-24233979,24234376-24234441,24234728-24234790,
           24236577-24236652,24238003-24238064,24238573-24238658,
           24238978-24239026,24239099-24239279,24239448-24239596,
           24239682-24239750,24240920-24240991,24241122-24241269,
           24241403-24241498,24242024-24242094,24242223-24242338,
           24242453-24242498,24242611-24242781
          Length = 860

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +2

Query: 299 IEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTDR 460
           I +EK  +L +++ IKH E++L   E  KDD T   D       +V + V  +R
Sbjct: 639 IRDEKVKVLQSVNPIKHDEVVLGQYEGYKDDPTVPDDSNTPTFASVVLRVHNER 692


>10_05_0092 - 9106725-9106769,9107172-9107367,9107525-9107898
          Length = 204

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 12/47 (25%), Positives = 23/47 (48%)
 Frame = +3

Query: 105 RFSESASQTMEVDQFALEIAYPEGSRLPLIDESSVLGTQAPKDRLIA 245
           +F   A+     ++F +  +YP G    L+D+  +  T  P D ++A
Sbjct: 50  QFVAGANHPNRNEEFVIASSYPNGFGTTLVDDWYLTATTNPNDNIVA 96


>08_02_1416 -
           26915306-26915459,26915553-26915668,26915798-26915910,
           26915995-26916130,26916219-26916338,26916472-26916648,
           26916790-26916862,26916948-26917083,26917179-26918055,
           26918138-26918331,26918438-26918620,26918730-26918796,
           26918900-26919092,26919317-26919363,26919478-26919574,
           26919663-26919790,26919905-26920009,26920763-26920879
          Length = 1010

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 3/42 (7%)
 Frame = +2

Query: 317 SLLSTLDSIKHSELLLDISECDK---DDITRYADRILSRAMT 433
           S +S L S    ELL   S CDK   DDITR A  IL    T
Sbjct: 433 STISPLPSKPSGELLRFFSACDKDVTDDITRRAGIILGAIFT 474


>07_03_0605 + 19908541-19909605,19909703-19910092
          Length = 484

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = -3

Query: 592 PAETCTRSYRSGNGNAHSLRRCARTSPAIDVHVHL 488
           PAE  T   RS  GN H   +C  +   +D H +L
Sbjct: 68  PAECRTAIIRSIEGNGHGHAQCIESRFFVDAHAYL 102


>03_02_0048 -
           5265595-5265783,5265882-5265992,5266259-5266547,
           5266647-5266903,5266995-5267356,5267447-5267522,
           5267618-5267707,5267800-5267891,5267995-5268098,
           5268191-5268253,5268609-5268736
          Length = 586

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +3

Query: 219 QAPKDRLIAVLDKSRCEWRGSEKTQSGLKKKRTPYF 326
           Q  KDR+     +   EW G+++ ++G   KR P++
Sbjct: 5   QHSKDRMFITRTEWATEWGGAKQKEAGTPFKRLPFY 40


>01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-336498,
            336577-336734,337180-337310,337385-337472,337587-337690,
            338346-338444,339060-339116,339262-339337,339519-339602,
            339969-340010,340128-340198,341516-341564,342370-342441,
            343149-343286,343393-343473,344166-344353,344591-345188,
            345274-345342,346729-346854,347048-347175,347986-348142,
            348342-348388,348472-348535,348691-348765,349292-349414,
            349797-349982,351179-351303,351390-351459,351974-352101,
            352585-352726,353065-353163,353239-353285,353598-353652,
            353758-353967,354686-354757,354836-354905,355231-355414,
            355521-355644,355732-355863,356252-356317,356805-356852,
            357572-357676,357728-357865,358097-358399,358482-358594,
            359082-359148,359236-359310,359395-359517,359610-359618,
            360156-360320,360401-360502,361545-361696,361794-361995,
            362079-362126,362215-362298,362613-362657,363302-363385,
            363890-363970,364044-364133,364217-364279,364824-364841,
            365238-365378,365494-365550,366091-366185,366275-366383,
            367067-367156,367308-367387,367480-367558,367742-367903,
            368005-368136,368335-368469,368553-368618,369317-369457,
            369575-369648,369685-369910
          Length = 2905

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -3

Query: 583  TCTRSYRSGNGNAHSLRRCARTSPAIDVHVHLIQSFLLLMVSVS 452
            T ++SY   NGN HS  R  +   + + HV L  S + L++++S
Sbjct: 1894 THSQSYCLFNGNLHSCLRALQNGDSEEFHVKLSNSKMDLVLALS 1937


>10_06_0139 -
           11139004-11139031,11139300-11141017,11141408-11141477,
           11142520-11143361
          Length = 885

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 17/43 (39%), Positives = 19/43 (44%)
 Frame = -3

Query: 274 LHSHLDLSSTAISLSFGACVPRTEDSSMRGSREPSGYAISNAN 146
           LH HL      I L  G   P +E  S   +  PSG  ISN N
Sbjct: 527 LHLHLRFDMNLIDL-MGHMTPPSELGSSSSNSSPSGGIISNLN 568


>02_01_0570 -
           4195409-4195443,4196245-4196333,4196539-4196630,
           4196726-4196833,4196984-4197118,4197211-4197256,
           4197358-4197458,4198285-4198422,4198503-4198601,
           4198740-4198856,4199195-4199356,4199734-4199793,
           4200371-4200538,4200608-4200718,4201401-4201499,
           4201579-4201644,4202407-4202490,4202563-4202605,
           4202684-4202739,4202817-4202925,4203442-4203524,
           4203842-4203925,4204311-4204382,4204462-4204539,
           4204633-4204716,4204806-4204876,4205943-4206012,
           4206495-4206626,4207168-4207284,4208185-4208367
          Length = 963

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +3

Query: 162 AYPEGSRLPLIDESSVLGTQAPKDRLIAV 248
           AY +  R  + D+ SV+G  +P D+L+ V
Sbjct: 630 AYSDAEREAVADQISVMGRSSPSDKLLLV 658


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,448,729
Number of Sequences: 37544
Number of extensions: 408676
Number of successful extensions: 1128
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1099
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1128
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1655832080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -