SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1596 + 34684943-34686340,34688085-34688175,34688290-346883...    32   0.39 
04_04_0548 + 26172595-26173189,26173346-26173473,26173606-261738...    29   4.8  
02_05_0436 - 28971733-28972020,28972178-28972525,28972738-289729...    29   4.8  
12_02_0447 + 19160178-19160302,19160531-19160813                       28   6.4  
11_06_0034 - 19448316-19449767                                         28   8.5  

>04_04_1596 +
           34684943-34686340,34688085-34688175,34688290-34688354,
           34688530-34688581,34688747-34688829,34688942-34689035,
           34689468-34690051
          Length = 788

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = -2

Query: 189 LVARAALSHSAEPVLRPAPELRDSQ*RLHRNCPPSFCAPR 70
           L+ R  L+H +EP+  P+P +  S  R     PPS   PR
Sbjct: 105 LLRRLGLAHDSEPLPHPSPRVSSSSPRSPTPSPPSSSPPR 144


>04_04_0548 +
           26172595-26173189,26173346-26173473,26173606-26173866,
           26173988-26174250,26176748-26177099
          Length = 532

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +2

Query: 452 LVQATIVVLAQAQVDTLQSMAKVFAPSKLFRPTPNSCQ 565
           L  A + VL  + V+ +QS   V  P  L  PTP+S +
Sbjct: 8   LYAAVLAVLLCSSVNFIQSPTDVLGPVALLEPTPSSAR 45


>02_05_0436 -
           28971733-28972020,28972178-28972525,28972738-28972920,
           28973096-28973170,28973238-28973392,28973540-28974043,
           28975889-28975964
          Length = 542

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
 Frame = +2

Query: 257 GRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSV----QPQTLSLNAITEFCDLVPR 424
           G R  C A+  SN+ +N++  ++ E    + +C++      +     L+  T   +LVP 
Sbjct: 175 GARGVCAALALSNAIINLSATIFGELWKLEPLCEEKKVRWRKEMDWLLSPTTYMVELVPT 234

Query: 425 QQFGEDG 445
           +Q G DG
Sbjct: 235 KQNGADG 241


>12_02_0447 + 19160178-19160302,19160531-19160813
          Length = 135

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +1

Query: 43  TNSECGKAGAWCTETWRTIT 102
           T S C  A +WCT T R IT
Sbjct: 91  TASSCSAASSWCTMTGRAIT 110


>11_06_0034 - 19448316-19449767
          Length = 483

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 14/57 (24%), Positives = 27/57 (47%)
 Frame = -2

Query: 603 LQHHEDSFVHLFSWHELGVGRKSFDGAKTLAMLCKVSTCAWAKTTMVACTKSSPSSP 433
           L  ++D  + ++ W++   G +S+ G      L  +  C W+   M A  +  P+SP
Sbjct: 243 LHKYKDHNLVVYGWNKEVYGERSWVGLNAGVFL--IRNCQWSLDFMDAWARMGPASP 297


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,210,363
Number of Sequences: 37544
Number of extensions: 467772
Number of successful extensions: 1552
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1504
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1552
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1851002996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -