SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0018 - 141542-142108                                             32   0.42 
01_07_0036 + 40647046-40647100,40647120-40647571,40648135-406482...    29   3.0  
12_01_0176 - 1308813-1309640                                           29   3.9  

>08_01_0018 - 141542-142108
          Length = 188

 Score = 31.9 bits (69), Expect = 0.42
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -1

Query: 541 DRTGH-VELSTRYINTDSFVYYQYRRYCHTFL*DFSTVHKSSSTRI 407
           D T H   L+ RY +  +  YY  +R+ H  L DFS    +++TRI
Sbjct: 50  DLTRHNARLALRYHSIAADAYYHDQRFAHALLPDFSQPASTNTTRI 95


>01_07_0036 +
           40647046-40647100,40647120-40647571,40648135-40648257,
           40648407-40648461,40648613-40648722,40649352-40649531,
           40650003-40650101,40651182-40651280,40652195-40652289,
           40652290-40652378,40652739-40652901,40653299-40653404,
           40655647-40655829,40656059-40656286,40656373-40656486
          Length = 716

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 455 CMTVASILIVDKTVCVDVTCGQFNVPCP 538
           CMT A  L++ + VC D++ GQ N+P P
Sbjct: 414 CMTCA--LLLSRLVCDDISGGQENLPIP 439


>12_01_0176 - 1308813-1309640
          Length = 275

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 18/70 (25%), Positives = 27/70 (38%)
 Frame = +2

Query: 236 RIPSRSALSIPPPQER*TFNSTLLEVALEVSLQK*VCSKFC*VQLYIYMFVSLLCLSYAS 415
           +IP    L +PPP     +       A    L+   C  FC V L + +  + + + Y  
Sbjct: 51  QIPKDQVLRVPPPDRARRYKKLAARPARRRRLRHACCGAFCGVLLLLLLAAAFVGVVYLV 110

Query: 416 GRGLVHSTKV 445
            R L  S  V
Sbjct: 111 FRPLAPSFSV 120


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,981,040
Number of Sequences: 37544
Number of extensions: 241148
Number of successful extensions: 507
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 501
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 507
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1502076244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -