SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0213 + 20974712-20975413                                         31   0.86 
05_01_0074 + 506803-507963                                             28   8.0  

>02_04_0213 + 20974712-20975413
          Length = 233

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 16/56 (28%), Positives = 26/56 (46%)
 Frame = +3

Query: 324 ITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRMFKKYSQLGVAALP 491
           + +E EE+ +    E  R  +A  EE     W+DF D  L ++ ++  Q   A  P
Sbjct: 73  VDEEEEEERMDQLWERDRDARAGDEERMDLLWEDFNDELLLQLRRRQQQRAAAGTP 128


>05_01_0074 + 506803-507963
          Length = 386

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = -3

Query: 656 HVSTPQGLGSWRISQLSQAPKIDRIYSHSCTSRSSRWR 543
           H S  Q   S    +L+ A     ++SH   SRS+ WR
Sbjct: 337 HSSNSQASSSHSRPELNDASDRSAVFSHGSRSRSTSWR 374


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,456,037
Number of Sequences: 37544
Number of extensions: 371474
Number of successful extensions: 1062
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1062
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1756684372
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -