SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20071
         (462 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0656 + 21601782-21601925,21602249-21602460,21602686-216028...    30   0.79 
09_02_0118 - 4451228-4452565                                           29   1.4  
03_06_0737 + 35879723-35879990,35880105-35880201,35880464-358805...    28   3.2  
09_06_0193 - 21460365-21460679,21460781-21460931,21461030-214612...    27   5.6  
03_04_0214 + 18688480-18688832,18688956-18688999,18689039-186891...    27   9.7  

>12_02_0656 +
           21601782-21601925,21602249-21602460,21602686-21602813,
           21602905-21602986,21603308-21603406,21603619-21604054,
           21604280-21604350,21604438-21604523,21604740-21604750
          Length = 422

 Score = 30.3 bits (65), Expect = 0.79
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +1

Query: 235 VSIAGNTLIKWTENKPVSE*IPLISMTFLLFYIY 336
           +++ G+T+ +W  N P+ E I LIS   L F  +
Sbjct: 164 LALQGSTVCRWYPNAPIQETISLISSAILYFLCF 197


>09_02_0118 - 4451228-4452565
          Length = 445

 Score = 29.5 bits (63), Expect = 1.4
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = +2

Query: 122 AYAHLAGACLASNFLYFVLILNVQYVH 202
           AYA L   CL+   LY V  L+V Y+H
Sbjct: 417 AYAELLDQCLSGLLLYVVCCLSVTYLH 443


>03_06_0737 +
           35879723-35879990,35880105-35880201,35880464-35880591,
           35880686-35880767,35880855-35880918,35880930-35881022,
           35881120-35881178,35881391-35881826,35882050-35882120,
           35882201-35882351
          Length = 482

 Score = 28.3 bits (60), Expect = 3.2
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +1

Query: 235 VSIAGNTLIKWTENKPVSE*IPLISMTFL 321
           +++ G+T+ +W  N P+ E I LIS + L
Sbjct: 167 LALQGSTVCRWYPNAPIQETISLISRSML 195


>09_06_0193 -
           21460365-21460679,21460781-21460931,21461030-21461267,
           21461364-21461571,21461776-21461975,21462085-21462186,
           21462617-21463967
          Length = 854

 Score = 27.5 bits (58), Expect = 5.6
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = -2

Query: 311 MLIKGIYSDTGLFSVHLISVFPAIETFYLSA*RLTGDGRIVHLVLEQNTENCLLDRHLLD 132
           +L+  I S + + S+ LI   P +  +   A  L  +G+   ++    T NCLLD  +L 
Sbjct: 724 VLLLEIVSGSKISSIDLIEDSPNLPVY---AWNLWNEGKADIMIDSTITANCLLDEVILC 780

Query: 131 VHKLL 117
           +H  L
Sbjct: 781 IHVAL 785


>03_04_0214 +
           18688480-18688832,18688956-18688999,18689039-18689101,
           18689883-18689956,18691526-18692017
          Length = 341

 Score = 26.6 bits (56), Expect = 9.7
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -2

Query: 248 PAIETFYLSA*RLT-GDGRIVHLVLEQNTENCLLDRHLLDV 129
           P I+TF +S    T G G I  + +  N+   +LD HL D+
Sbjct: 205 PTIKTFQISTNPTTEGLGIISEVPIRYNSVEVILDFHLFDI 245


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,477,227
Number of Sequences: 37544
Number of extensions: 160273
Number of successful extensions: 286
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 286
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 919380308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -