SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_06_0182 - 11552540-11552606,11552692-11552787,11553458-115535...    91   7e-19
01_01_0780 - 6036454-6037992                                           29   3.1  
09_06_0246 + 21837144-21838194,21838692-21840038,21840576-218406...    29   4.1  
07_01_0511 + 3806475-3806876,3807914-3808039,3808120-3808193,380...    29   4.1  
09_06_0020 - 20267190-20267612,20269086-20269495,20269573-202697...    28   5.4  
06_03_1312 - 29246828-29246899,29247011-29247058,29247138-292472...    27   9.5  
05_01_0315 - 2468267-2468293,2469021-2469070,2469159-2469234,246...    27   9.5  
03_01_0526 + 3956909-3957071,3957262-3957317,3957398-3957462,395...    27   9.5  

>10_06_0182 -
           11552540-11552606,11552692-11552787,11553458-11553528,
           11553660-11553764,11554149-11554239,11554331-11554381,
           11554478-11554566,11554667-11554909,11555027-11555190,
           11555883-11555988,11556075-11556242,11557456-11557494,
           11557582-11557713
          Length = 473

 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 43/80 (53%), Positives = 57/80 (71%)
 Frame = +2

Query: 269 MTSSMNQCNTVTRYLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHS 448
           +++S +       +L Q EAA +D+ L     FSVDQLMELAGLSVA+A+A+V+    H+
Sbjct: 6   VSASASASGEEVTHLAQREAAEIDEQLMGPLGFSVDQLMELAGLSVAAAVAEVYKLGEHT 65

Query: 449 SALIVCGPGNNGGDGLVAAR 508
             L++CGPGNNGGDGLVAAR
Sbjct: 66  RVLVICGPGNNGGDGLVAAR 85



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 17/24 (70%), Positives = 17/24 (70%)
 Frame = +1

Query: 520 FGYNVSVHYPKRTPKPLYENLLEQ 591
           FGY  SV YPKRTPKPLY  L  Q
Sbjct: 90  FGYKPSVCYPKRTPKPLYSGLCTQ 113


>01_01_0780 - 6036454-6037992
          Length = 512

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = +2

Query: 371 VDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYIIL 550
           VD LM+     +  A A   PP  H+S +     GN   D L AA+  S S   +    L
Sbjct: 272 VDYLMQETVREIDEAAAAGLPPPPHTSDM---ETGNLLFDFLFAAQDASTSSLCWAVSAL 328

Query: 551 NAHPNL 568
           ++HP++
Sbjct: 329 DSHPDV 334


>09_06_0246 +
           21837144-21838194,21838692-21840038,21840576-21840656,
           21842740-21842924
          Length = 887

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPS-THSSALIVCGPGNNGG 487
           L  +E    D +  +  ++++ Q    +    A+A+A  FP S T +  L +C P ++GG
Sbjct: 322 LRDAERIVYDDNGCSYKQYTISQYFTTSA-GEAAAMATAFPYSFTRTKHLTLCPPSSHGG 380

Query: 488 D 490
           D
Sbjct: 381 D 381


>07_01_0511 + 3806475-3806876,3807914-3808039,3808120-3808193,
            3808278-3808347,3808431-3808486,3808578-3808649,
            3808678-3808811,3808967-3809030,3809111-3809240,
            3809326-3809541,3809629-3809750,3810527-3810701,
            3810788-3810878,3811040-3811197,3811330-3811518,
            3813257-3813340,3813362-3813536,3815300-3815955,
            3816226-3816648,3816752-3816790
          Length = 1151

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = -1

Query: 588  FQKVFIQRFGCAFRIMYRYIVSEQLHILAATKPSPPLFPGP 466
            F K+F +  G      +  +V   +++LA + P+ PL P P
Sbjct: 1061 FPKIFSRHMGHVLYAAFSVLVIYSIYLLALSTPTSPLAPPP 1101


>09_06_0020 -
           20267190-20267612,20269086-20269495,20269573-20269747,
           20270833-20271066,20271164-20271265,20271354-20272091,
           20272204-20272321,20272417-20272667,20272768-20272932
          Length = 871

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +2

Query: 362 KFSVDQLMELAGLSVA---SAIAKVFPPSTHSSALIVCGPGNNGGDGLVA 502
           K  +D++  LAG  +    S+I+   PPS  + + +  G G+NGG GL A
Sbjct: 239 KDELDRVCALAGKFLGRPISSISSPGPPSLQACSGLELGVGSNGGFGLGA 288


>06_03_1312 -
           29246828-29246899,29247011-29247058,29247138-29247215,
           29247304-29247360,29247597-29247662,29247750-29247839,
           29248136-29248213,29248318-29248422,29248534-29248669,
           29248778-29248853,29248973-29249177,29249289-29249501,
           29250073-29250795
          Length = 648

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = -3

Query: 436 GWE-DLGNGTSNTQASKFHKLIDTKLVFSE 350
           GWE D G+   NT AS+F + ID    FSE
Sbjct: 344 GWEVDQGSYFPNTFASRFDEGIDASFDFSE 373


>05_01_0315 -
           2468267-2468293,2469021-2469070,2469159-2469234,
           2469498-2469575,2469967-2470048,2470146-2470238,
           2470564-2470673,2470831-2470893,2471293-2471344,
           2471421-2471545,2472681-2472794,2472917-2472961,
           2473278-2473337,2474725-2474778,2474944-2474992,
           2475071-2475252,2475349-2475404,2475491-2475584
          Length = 469

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -2

Query: 185 YCFSFTNN-RYVVWFQMSVKIIFYLNPMCM-LPI*VGIIDYTLNGMICIIMYYSLIYIFT 12
           YC+S       +VW  +SV  + YL+  C+   + + +I+Y++   +  + Y S+ ++F 
Sbjct: 83  YCYSLKGRGASLVWLLLSVTYLCYLHGACVSFILLIALINYSI-VKVLEVAYLSIEHMFV 141

Query: 11  N 9
           +
Sbjct: 142 D 142


>03_01_0526 +
           3956909-3957071,3957262-3957317,3957398-3957462,
           3957560-3958006,3958102-3958227,3958328-3958511,
           3958788-3958943
          Length = 398

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = -1

Query: 525 SEQLHILAATKPSPPLFPGPHTIRADE*VEGGKTLA 418
           S  L  + AT P+P  FP P T R      GG ++A
Sbjct: 303 SSVLKEVKATPPTPQRFPSPSTNRVKNVKAGGMSMA 338


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,128,666
Number of Sequences: 37544
Number of extensions: 331997
Number of successful extensions: 822
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 807
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 822
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1573040476
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -