SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0654 - 5639419-5641449                                          141   5e-34
02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84...   141   5e-34
05_04_0392 - 20889699-20891726                                        140   8e-34
05_04_0052 - 17515344-17517353                                        136   2e-32
01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229    131   5e-31
03_02_0546 - 9381989-9383733,9385838-9386054                          130   7e-31
05_05_0109 - 22454539-22456268,22457069-22457279                      130   9e-31
03_02_0540 + 9340379-9340592,9341250-9342988                          130   9e-31
03_05_0877 + 28443481-28443538,28443641-28443911,28444028-284442...   129   2e-30
11_08_0075 + 28173220-28173433,28175348-28177083                      128   3e-30
03_06_0484 + 34233042-34233258,34235317-34237049                      128   5e-30
03_02_0542 - 9348126-9349585,9352433-9352655                          114   6e-26
11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,443...   109   1e-24
11_01_0564 - 4447078-4448519,4449465-4449711                          108   3e-24
01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819    108   4e-24
02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090...    97   1e-20
01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165     95   5e-20
03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74...    94   1e-19
12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231           89   3e-18
05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906...    68   5e-12
01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937,425...    64   1e-10
05_01_0550 + 4820086-4821255,4822112-4822321,4822429-4822524,482...    62   4e-10
12_01_0346 + 2652181-2653566                                           49   4e-06
11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836           42   3e-04
03_02_0180 - 6211823-6213559                                           40   0.001
12_02_0825 + 23476943-23476952,23477263-23477328,23477737-234778...    37   0.012
06_03_1137 + 27903012-27904196,27904330-27904542,27905775-279058...    33   0.19 
01_06_1620 + 38697960-38698131,38698532-38700732                       29   3.1  
01_07_0105 - 41104655-41104851,41105818-41107150                       28   5.4  
01_06_1561 - 38255397-38255595,38255712-38255867,38256040-38257163     28   7.1  

>08_01_0654 - 5639419-5641449
          Length = 676

 Score =  141 bits (341), Expect = 5e-34
 Identities = 64/78 (82%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           GTVIGIDLGTTYSCVGVY+NG VEIIANDQGNRITPS+VAFT  GERLIG+AAKNQ   N
Sbjct: 44  GTVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAAN 103

Query: 452 PENTVFDAKRLIGREWSD 505
           PE T++DAKRLIGR++SD
Sbjct: 104 PERTIYDAKRLIGRQFSD 121



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D+K  PF VV++N KPHV+V+   GD +VF+PEE+SAMVL
Sbjct: 124 VQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAMVL 166


>02_01_0112 -
           839048-839552,839638-839720,839828-839982,840078-840557,
           840855-841097,841189-841403,841489-841756,842477-842525
          Length = 665

 Score =  141 bits (341), Expect = 5e-34
 Identities = 66/86 (76%), Positives = 75/86 (87%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAA 430
           +E+ K +GTVIGIDLGTTYSCVGVYKNG VEIIANDQGNRITPS+VAFT D ERLIG+AA
Sbjct: 26  KEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFT-DSERLIGEAA 84

Query: 431 KNQLTTNPENTVFDAKRLIGREWSDQ 508
           KNQ   NPE T+FD KRLIGR++ D+
Sbjct: 85  KNQAAVNPERTIFDVKRLIGRKFEDK 110



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D+K  P+K+V K+ KP++QV+   G+ KVF+PEE+SAM+L
Sbjct: 112 VQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMIL 154


>05_04_0392 - 20889699-20891726
          Length = 675

 Score =  140 bits (339), Expect = 8e-34
 Identities = 64/78 (82%), Positives = 71/78 (91%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           GTVIGIDLGTTYSCVGVY+N RVEIIANDQGNRITPS+VAFT  GERLIG+AAKNQ   N
Sbjct: 44  GTVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAAN 103

Query: 452 PENTVFDAKRLIGREWSD 505
           PE T++DAKRLIGR++SD
Sbjct: 104 PERTIYDAKRLIGRQFSD 121



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D+K  PF VV++N KPHV+V+   GD +VF+PEE+SAMVL
Sbjct: 124 VQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAMVL 166


>05_04_0052 - 17515344-17517353
          Length = 669

 Score =  136 bits (328), Expect = 2e-32
 Identities = 63/78 (80%), Positives = 69/78 (88%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           GTVIGIDLGTTYSCVGVY+NG VEIIANDQGNRITPS+VAFT  GERLIG+AAKNQ   N
Sbjct: 39  GTVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAAN 98

Query: 452 PENTVFDAKRLIGREWSD 505
           P  TV+DAKRLIGR ++D
Sbjct: 99  PGRTVYDAKRLIGRRFAD 116



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D++  PF VV+K  KPHV+V+   GD ++ +PEE+SAMVL
Sbjct: 119 VQRDMRLLPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVSAMVL 161


>01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229
          Length = 841

 Score =  131 bits (316), Expect = 5e-31
 Identities = 65/84 (77%), Positives = 70/84 (83%)
 Frame = +2

Query: 254 EKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAK 433
           E  K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAK
Sbjct: 193 EMAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAK 251

Query: 434 NQLTTNPENTVFDAKRLIGREWSD 505
           NQ+  NP NTVFDAKRLIGR +SD
Sbjct: 252 NQVAMNPINTVFDAKRLIGRRFSD 275



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P+VQ D+K +PFKV+     KP + VQ    +K F+ EEIS+MVL
Sbjct: 276 PSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEISSMVL 320


>03_02_0546 - 9381989-9383733,9385838-9386054
          Length = 653

 Score =  130 bits (315), Expect = 7e-31
 Identities = 64/82 (78%), Positives = 70/82 (85%)
 Frame = +2

Query: 260 DKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQ 439
           +K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ
Sbjct: 4   NKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 62

Query: 440 LTTNPENTVFDAKRLIGREWSD 505
           +  NP NTVFDAKRLIGR +SD
Sbjct: 63  VAMNPTNTVFDAKRLIGRRFSD 84



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P+VQ D+K +PFKVV     KP + V     +K F+ EEIS+MVL
Sbjct: 85  PSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFSAEEISSMVL 129


>05_05_0109 - 22454539-22456268,22457069-22457279
          Length = 646

 Score =  130 bits (314), Expect = 9e-31
 Identities = 64/81 (79%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 3   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQV 61

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 62  AMNPTNTVFDAKRLIGRRFSD 82



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P+VQ D+K +PFKVV     KP + VQ    +K FA EEIS+MVL
Sbjct: 83  PSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEISSMVL 127


>03_02_0540 + 9340379-9340592,9341250-9342988
          Length = 650

 Score =  130 bits (314), Expect = 9e-31
 Identities = 64/81 (79%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 4   KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 63  AMNPINTVFDAKRLIGRRFSD 83



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D K +PFKV+     KP + VQ    +K F+ EEIS+MVL
Sbjct: 85  SVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSAEEISSMVL 128


>03_05_0877 +
           28443481-28443538,28443641-28443911,28444028-28444242,
           28444329-28445057,28445143-28445297,28445384-28445965
          Length = 669

 Score =  129 bits (311), Expect = 2e-30
 Identities = 59/82 (71%), Positives = 69/82 (84%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G VIGIDLGTTYSCVGVY+NG V+I+ANDQGNRITPS+VAFT D ERL+G+AAKNQ 
Sbjct: 34  KTKGPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDD-ERLVGEAAKNQA 92

Query: 443 TTNPENTVFDAKRLIGREWSDQ 508
             NP+ T+FD KRLIGR + D+
Sbjct: 93  ALNPDRTIFDIKRLIGRRFDDE 114



 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ DVK+ P+KVV+K  KP+V+V+   G+ KVF+PEEISAM+L
Sbjct: 116 VQRDVKYLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEISAMIL 158


>11_08_0075 + 28173220-28173433,28175348-28177083
          Length = 649

 Score =  128 bits (310), Expect = 3e-30
 Identities = 63/81 (77%), Positives = 68/81 (83%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYV FT D ERLIGDAAKNQ+
Sbjct: 4   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 63  AMNPINTVFDAKRLIGRRFSD 83



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFKV+     KP + VQ    +K FA EEIS+MVL
Sbjct: 85  SVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAAEEISSMVL 128


>03_06_0484 + 34233042-34233258,34235317-34237049
          Length = 649

 Score =  128 bits (308), Expect = 5e-30
 Identities = 63/81 (77%), Positives = 68/81 (83%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYV FT D ERLIGDAAKNQ+
Sbjct: 5   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFT-DTERLIGDAAKNQV 63

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 64  AMNPINTVFDAKRLIGRRFSD 84



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +P+KV+     KP + VQ    +K F+ EEIS+MVL
Sbjct: 86  SVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEISSMVL 129


>03_02_0542 - 9348126-9349585,9352433-9352655
          Length = 560

 Score =  114 bits (274), Expect = 6e-26
 Identities = 56/80 (70%), Positives = 62/80 (77%)
 Frame = +2

Query: 266 DIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLT 445
           D G  +GIDLGTTYSCV V++ GRVE+I NDQGN  TPS VAFT D  RLIGDAA NQ  
Sbjct: 8   DDGPAVGIDLGTTYSCVAVWRRGRVEVIPNDQGNLTTPSCVAFT-DTWRLIGDAALNQAA 66

Query: 446 TNPENTVFDAKRLIGREWSD 505
            NP NT+FDAKRLIGR +SD
Sbjct: 67  MNPLNTIFDAKRLIGRRFSD 86



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFKV   K+ +P + VQ    +K F+ EEISAMVL
Sbjct: 88  SVQGDIKLWPFKVTSGKDDRPMIVVQYRGEEKEFSAEEISAMVL 131


>11_01_0563 +
           4423609-4423846,4424671-4426132,4428949-4429364,
           4430555-4432052,4432199-4432217,4432469-4432675,
           4432814-4433065
          Length = 1363

 Score =  109 bits (263), Expect = 1e-24
 Identities = 51/79 (64%), Positives = 61/79 (77%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSC  V ++ R E+I NDQGNRITPS VAFT D +R +GDAA+NQ   N
Sbjct: 641 GPAIGIDLGTTYSCAAVRRHNRSEVITNDQGNRITPSCVAFTAD-DRFVGDAAENQAALN 699

Query: 452 PENTVFDAKRLIGREWSDQ 508
           P NT+F+AKRLIGR +S +
Sbjct: 700 PTNTIFEAKRLIGRRFSSK 718



 Score =  106 bits (255), Expect = 1e-23
 Identities = 51/79 (64%), Positives = 59/79 (74%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G  IGIDLGTTYSCV V +  R E I NDQGNRITPS VAFT   +R +GDAA+NQ   N
Sbjct: 15  GPAIGIDLGTTYSCVAVRRRYRSEAITNDQGNRITPSCVAFTA-ADRFVGDAAENQAALN 73

Query: 452 PENTVFDAKRLIGREWSDQ 508
           P NT+F+ KRLIGR +SD+
Sbjct: 74  PTNTIFEVKRLIGRRFSDK 92



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 21/44 (47%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFKV+  ++ +P + V+    +K F PEEISAMVL
Sbjct: 93  SVQEDIKLWPFKVIAGRDDRPTIVVRHEGKEKQFVPEEISAMVL 136



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFKVV   + +P + VQ    +  F PEEISAMVL
Sbjct: 719 SVQEDIKLWPFKVVAGPDDRPTIVVQHEGKEMQFVPEEISAMVL 762


>11_01_0564 - 4447078-4448519,4449465-4449711
          Length = 562

 Score =  108 bits (260), Expect = 3e-24
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT-QDGERLIGDAAKNQLTT 448
           G  +GIDLGTTYSCV V+++ R E+IANDQGNR+TPS VAFT  D +  +GDAA NQ   
Sbjct: 16  GPAVGIDLGTTYSCVAVWRHDRGEVIANDQGNRLTPSCVAFTADDDDSFVGDAAFNQSAL 75

Query: 449 NPENTVFDAKRLIGREWSD 505
           NP NT+F+ KRLIGR +SD
Sbjct: 76  NPTNTIFEVKRLIGRRFSD 94



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFKVV  +  +P + V+    ++ F PEEIS+MVL
Sbjct: 96  SVQKDIKLWPFKVVAGQEDRPMIVVRHEGEERQFMPEEISSMVL 139


>01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819
          Length = 539

 Score =  108 bits (259), Expect = 4e-24
 Identities = 51/78 (65%), Positives = 60/78 (76%)
 Frame = +2

Query: 272 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           G VIGIDLGT  SCV V++NGR EI+ N+ G R TPSY AFT D ERL+GDAAK+Q + N
Sbjct: 9   GPVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFT-DTERLVGDAAKSQASRN 67

Query: 452 PENTVFDAKRLIGREWSD 505
           P NTVF  KRL+GR +SD
Sbjct: 68  PTNTVFATKRLMGRRFSD 85



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ  +K +PFKVV  +  KP V        K+ A EE+++M+L
Sbjct: 87  SVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKLLAAEEVASMLL 130


>02_05_0916 -
           32706039-32706332,32707483-32708103,32708450-32709070,
           32709183-32709752,32709840-32709918,32710002-32710075,
           32711336-32711398
          Length = 773

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 47/92 (51%), Positives = 57/92 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT SCV V +    ++I N +G R TPS VAF Q GERL+G  AK Q  TNP+
Sbjct: 54  VIGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGERLVGTPAKRQAVTNPQ 113

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           NT F  KRLIGR + D      +   P + +K
Sbjct: 114 NTFFGTKRLIGRRFEDPQTQKEMKMVPYKIVK 145


>01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165
          Length = 648

 Score = 94.7 bits (225), Expect = 5e-20
 Identities = 45/77 (58%), Positives = 56/77 (72%), Gaps = 1/77 (1%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERL-IGDAAKNQLTTNP 454
           V+GID+G TYSCV VY  GRVEII NDQG+R+TPS+VAFT  G RL +G+AAK Q   +P
Sbjct: 36  VLGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSP 95

Query: 455 ENTVFDAKRLIGREWSD 505
              V D  RL+G++  D
Sbjct: 96  GRAVHDFMRLLGKKLGD 112



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 20/43 (46%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ ++   P+ VV+   KPHV V+ + GD +V +PEEI+A VL
Sbjct: 115 VQREMTRLPYAVVDMEGKPHVLVEAADGDVRVLSPEEIAAAVL 157


>03_01_0093 -
           745434-746057,746492-747112,747222-747791,747870-747948,
           748258-748331,748385-748387
          Length = 656

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 46/92 (50%), Positives = 56/92 (60%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT SCV V +    ++I N +G R TPS VAF Q GE L+G  AK Q  TNP+
Sbjct: 34  VIGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVTNPQ 93

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           NT F  KRLIGR + D      +   P + +K
Sbjct: 94  NTFFGTKRLIGRRFDDPQTQKEMKMVPYKIVK 125


>12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231
          Length = 270

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 40/76 (52%), Positives = 51/76 (67%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S V   + G+  +I N +G R TPS VA+T+ GERL+G  AK Q   NPE
Sbjct: 53  VVGIDLGTTNSAVAAMEGGKPTVITNAEGQRTTPSVVAYTKGGERLVGQIAKRQAVVNPE 112

Query: 458 NTVFDAKRLIGREWSD 505
           NT F  KR IGR+ ++
Sbjct: 113 NTFFSVKRFIGRKMAE 128


>05_03_0397 +
           13488642-13488941,13489711-13489963,13490594-13490673,
           13491251-13491393,13491512-13491610,13491785-13491974,
           13492504-13492902,13492993-13493400
          Length = 623

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 326 KNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSD 505
           + G+  I+ N +G R TPS VA+T+ G+RL+G  AK Q   NPENT F  KR IGR+ ++
Sbjct: 2   EGGKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMNE 61


>01_01_0573 +
           4253484-4254653,4255526-4255735,4255842-4255937,
           4256034-4256255,4256829-4257023,4257097-4257243,
           4257323-4257472,4257762-4257892,4257978-4258194
          Length = 845

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 32/90 (35%), Positives = 51/90 (56%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G DLG     V V +   ++++ N++  R TP+ V F  D +R IG A     T NP
Sbjct: 2   SVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFG-DKQRFIGTAGAASSTMNP 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
           +N+V   KRL+GR++SD      +++ P R
Sbjct: 61  KNSVSQIKRLLGRKYSDPELQRDIAAFPFR 90



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +Q D+  FPF+V E  +  P V  +    ++VF P ++ AMVL
Sbjct: 78  PELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAMVL 122


>05_01_0550 +
           4820086-4821255,4822112-4822321,4822429-4822524,
           4822610-4822828,4823201-4823395,4823466-4823612,
           4823712-4823861,4825015-4825145,4825234-4825477
          Length = 853

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 32/90 (35%), Positives = 49/90 (54%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G     V V +   ++++ N++  R TP+ V F  D +R IG A     T NP
Sbjct: 2   SVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFG-DKQRFIGTAGAASSTMNP 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSPSR 544
            N+V   KRL+GR ++D      L+S P R
Sbjct: 61  RNSVSQIKRLLGRAFADPELQRDLASFPFR 90


>12_01_0346 + 2652181-2653566
          Length = 461

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/56 (48%), Positives = 34/56 (60%)
 Frame = +2

Query: 269 IGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKN 436
           +GTVI +DLG T SCV  Y +   E  A        P+ VAFT DG+ L+G+AAKN
Sbjct: 43  LGTVIAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKN 95


>11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836
          Length = 526

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFKV+   + +P + VQ    +  F PEE+SAMVL
Sbjct: 29  SVQEDIKLWPFKVIAGPDDRPTIVVQHEGKEMQFVPEEVSAMVL 72


>03_02_0180 - 6211823-6213559
          Length = 578

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 6/83 (7%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQD--GERLIGDAAKNQLTTNP 454
           IGID+GT+   V V+   +VE++ N +  +   SYV F  D     + G A +       
Sbjct: 29  IGIDIGTSNCSVAVWTGHQVELLKNTRNQKGMRSYVMFKDDSLSAGVTGGATREHGHEER 88

Query: 455 E----NTVFDAKRLIGREWSDQL 511
           +    + +F+ KRLIGR  +D++
Sbjct: 89  DILSGSAIFNMKRLIGRMDTDEV 111


>12_02_0825 +
           23476943-23476952,23477263-23477328,23477737-23477885,
           23478148-23478212,23479247-23479710,23479724-23480208
          Length = 412

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+  +PFKV+     K  + VQ    +K FA EEIS+MVL
Sbjct: 115 SVQSDIMLWPFKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVL 158



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEI 621
           +VQ D+K +PFKV+     K  + VQ    +K  A E+I
Sbjct: 39  SVQSDIKLWPFKVIAGPGDKSTIVVQYKGEEKQVAAEQI 77


>06_03_1137 +
           27903012-27904196,27904330-27904542,27905775-27905867,
           27905940-27906008,27906412-27906612,27906688-27906834,
           27907524-27907652,27909001-27909131,27909240-27909333
          Length = 753

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN- 451
           +V+G D+G         +   ++++ N + NR +P+ VAF+ +  RL+G  A    +++ 
Sbjct: 2   SVVGFDVGNDTLVAAAARQRGIDVLLNAESNRESPAAVAFSHNA-RLLGPHAAGAASSHA 60

Query: 452 PENTVFDAKRLIGR 493
           P +++     L GR
Sbjct: 61  PFSSIKRLLLLAGR 74


>01_06_1620 + 38697960-38698131,38698532-38700732
          Length = 790

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
 Frame = +2

Query: 365 NRITPSYVAFTQDGERLIGDAAKNQLTT-NPENTVFDAKRLIGREWSDQLYNMMLSSSPS 541
           N+I    V +  + ++ I D   + LT  N  N V          WS  + N  ++SSP 
Sbjct: 72  NKIPVQTVVWVANRDKPITDPTSSNLTILNDGNIVLLVNHSESPVWSTNIVNNTIASSPV 131

Query: 542 RSLKRTANLMFKYK 583
             L  + NL+ +++
Sbjct: 132 AVLLDSGNLVVRHE 145


>01_07_0105 - 41104655-41104851,41105818-41107150
          Length = 509

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 19/71 (26%), Positives = 32/71 (45%)
 Frame = -1

Query: 318 PTHE*VVPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNSTAS*PCKIYRLKDSEINKNL 139
           PT   +  K   + VPM   F   +         +A T + A+   KI   +D   NKN 
Sbjct: 156 PTKVAIDEKKEDVVVPMKEEFVKEKEKITDAKNDVASTENVAAVDEKIKAEEDKNKNKND 215

Query: 138 NKIIFTATIRS 106
           ++++ TAT+ +
Sbjct: 216 DEVVATATMEA 226


>01_06_1561 - 38255397-38255595,38255712-38255867,38256040-38257163
          Length = 492

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = +2

Query: 365 NRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRL--IGREWSDQLYNMMLSSSP 538
           N+ +   V F +D  R+     ++ L  + ++ +++  +   I  EW+D + N++L +SP
Sbjct: 43  NQSSELEVEFDEDDIRMKLQELEHALLDDSDDILYEISQAGSINDEWADPMKNVILPNSP 102

Query: 539 SRS 547
             S
Sbjct: 103 KES 105


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,006,199
Number of Sequences: 37544
Number of extensions: 361743
Number of successful extensions: 908
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 830
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 873
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -