SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0161 - 18757122-18757331,18757931-18758488                       31   0.55 
02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859,154...    30   1.7  
12_02_1075 - 25854662-25855015,25855895-25856045,25856141-258563...    29   3.0  
11_01_0193 - 1534051-1534092,1536343-1537065                           27   9.0  

>01_05_0161 - 18757122-18757331,18757931-18758488
          Length = 255

 Score = 31.5 bits (68), Expect = 0.55
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = -1

Query: 118 LPGPCPHVVANSLTSVQPLNNGYT*FLES 32
           LP P PHV++N +  +Q L N YT  L S
Sbjct: 180 LPRPTPHVISNIIKIMQNLRNAYTLALPS 208


>02_01_0232 +
           1543597-1543800,1544189-1544377,1544695-1544859,
           1545199-1545459,1546059-1546271,1546365-1546587,
           1547974-1548149
          Length = 476

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +3

Query: 270 LSQRLHMLCISGIQTSQVQLPRNRY 344
           L QRL +LCI G+ T  +++ R+RY
Sbjct: 445 LMQRLTVLCIRGVSTYPIKIIRSRY 469


>12_02_1075 -
           25854662-25855015,25855895-25856045,25856141-25856378,
           25856494-25856704,25856973-25857088,25857844-25857877,
           25857996-25858253
          Length = 453

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -3

Query: 602 EVTASYCSQTSQDEGSLGCCWIG*LRKG 519
           + T ++CS     +GS GC ++G LR G
Sbjct: 115 KATKNFCSGHKLGQGSFGCVYLGKLRNG 142


>11_01_0193 - 1534051-1534092,1536343-1537065
          Length = 254

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 325 SFLEI-GTQKFGDDILDLVVENADPRYPINLDDFMFKKL 438
           SFL+    Q+  DD +DLV+   DP + I  D  ++  L
Sbjct: 118 SFLDCYARQQLFDDAVDLVLNQLDPLFGIQADTVVYNHL 156


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,942,355
Number of Sequences: 37544
Number of extensions: 319702
Number of successful extensions: 1043
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1000
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1043
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1490248872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -