SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_1117 - 30526126-30526640,30527114-30527186,30527310-305278...    28   5.6  
05_04_0415 - 21080600-21080941,21081119-21081217,21085363-210854...    27   9.7  
02_04_0117 + 19914704-19915830,19916575-19916860,19917047-19918258     27   9.7  

>03_05_1117 -
           30526126-30526640,30527114-30527186,30527310-30527848,
           30528215-30528332
          Length = 414

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/33 (39%), Positives = 15/33 (45%)
 Frame = -3

Query: 317 CDVCCHMTLTCTNCYALICAVRT*SASSGGRLY 219
           CD+CC M   C  C  + C  R    S GG  Y
Sbjct: 84  CDLCCKMPDFCRECCCVFCR-RVVDYSFGGYSY 115


>05_04_0415 -
           21080600-21080941,21081119-21081217,21085363-21085455,
           21085802-21085855,21085943-21086044,21086449-21086523,
           21086662-21086784
          Length = 295

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 428 QSIFFVQNNYKSSFQSHTSNEV 363
           QSI+F +N+Y  +F + TS E+
Sbjct: 208 QSIYFTKNDYFPTFSAQTSGEI 229


>02_04_0117 + 19914704-19915830,19916575-19916860,19917047-19918258
          Length = 874

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +2

Query: 182 LSSKNTWPSSVLCTNGHPRKQTRYALHRL 268
           L    T+ +++ C  GHP  +T + LH L
Sbjct: 323 LVGHGTYQTNIRCRTGHPSLETLWGLHTL 351


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,108,665
Number of Sequences: 37544
Number of extensions: 325370
Number of successful extensions: 745
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 745
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1608522592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -