SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738,842...    31   0.69 
11_06_0764 + 27108979-27110018,27110176-27112270                       29   2.8  
02_02_0367 + 9496893-9497022,9498262-9498442,9498519-9498660,949...    29   2.8  
07_03_0630 - 20097672-20097772,20097983-20102012                       29   4.8  
06_03_0181 + 17618888-17619125,17621503-17621683,17621765-176219...    29   4.8  
03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477,813...    29   4.8  
11_06_0053 + 19667076-19667774,19668001-19669803,19669911-19669928     28   6.4  
08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366...    28   6.4  
02_03_0292 - 17358129-17358213,17358462-17358541,17358627-173587...    28   6.4  

>01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738,
            8421885-8421980,8422064-8422192,8422266-8422445,
            8422524-8422634,8422714-8422869,8422983-8423078,
            8423160-8423327,8423402-8423642,8423724-8423851,
            8424042-8424134,8424214-8424309,8424431-8424523,
            8424741-8424850,8424999-8425134,8425215-8425315,
            8426029-8426152,8426237-8426411,8426523-8426681,
            8427423-8427536,8427669-8427848,8428926-8429005
          Length = 1113

 Score = 31.5 bits (68), Expect = 0.69
 Identities = 21/63 (33%), Positives = 33/63 (52%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G + ST+     +V +VK  L+G +  +  L+     NN  ILV   A  QLC
Sbjct: 868  DNNIIAIGMEDSTIHIYNVRVDEVKTRLKGHQRRITGLAF---SNNLQILVSSGADAQLC 924

Query: 322  IFS 330
            +++
Sbjct: 925  VWA 927


>11_06_0764 + 27108979-27110018,27110176-27112270
          Length = 1044

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 339 LDLNTLASIAIVGLI--LNFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSIVISYNNW 512
           L+L  + S+ + G +  + F  F   +I  Q+     W G  E+   EIC+ +V+ Y + 
Sbjct: 633 LNLAQVRSLTVFGNLNHVPFHSFNYGII--QVLDLEGWKGLKERHVTEICQMLVLKYLSI 690

Query: 513 *FTSIHSIPYEI 548
             T I  IP +I
Sbjct: 691 RRTEIAKIPSKI 702


>02_02_0367 +
           9496893-9497022,9498262-9498442,9498519-9498660,
           9498757-9498826,9498920-9499089
          Length = 230

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 12/43 (27%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +3

Query: 261 VILWEQQWHPCAIVGSMTIMYLLIWLLDLN--TLASIAIVGLI 383
           V+LW+ +    A++G  T++++L  ++D +  TL S  ++G++
Sbjct: 47  VLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVL 89


>07_03_0630 - 20097672-20097772,20097983-20102012
          Length = 1376

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = +3

Query: 381 ILNFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSI 491
           + NFV    PVI + L    SW       F E CRS+
Sbjct: 383 VANFVGTAGPVILDPLQSDDSWALLRRYAFVEPCRSL 419


>06_03_0181 +
           17618888-17619125,17621503-17621683,17621765-17621906,
           17622002-17622071,17622162-17622307,17623382-17623948,
           17624558-17624641,17624723-17624797,17625049-17625217,
           17625395-17625586,17625662-17626053
          Length = 751

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 2/43 (4%)
 Frame = +3

Query: 261 VILWEQQWHPCAIVGSMTIMYLLIWLLD--LNTLASIAIVGLI 383
           V+LW+ +     ++G  T++++L  +LD  L TL S  ++G +
Sbjct: 83  VLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGAL 125


>03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477,
            8136560-8136655,8136746-8136874,8136947-8137123,
            8137256-8137366,8138592-8138792,8139022-8139186,
            8139293-8139527,8139618-8139745,8139833-8139928,
            8140017-8140112,8140252-8140325,8140393-8140462,
            8140556-8140665,8140753-8140906,8141040-8141155,
            8141259-8141379,8141464-8141641,8142331-8142489,
            8142619-8142732,8142821-8143000,8143098-8143177
          Length = 1117

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G   ST+Q    ++ +VK  L G    +  L+     N   +LV   A  Q+C
Sbjct: 876  DNNIIAIGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAF---SNVLNVLVSSGADAQIC 932

Query: 322  IFS 330
            ++S
Sbjct: 933  VWS 935


>11_06_0053 + 19667076-19667774,19668001-19669803,19669911-19669928
          Length = 839

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%)
 Frame = -1

Query: 530 MNGCKSPIIVAYYNASTNFFKCLLVLSC-PRTRSI--KLVAYNW 408
           +N  +  + V+YYN   +   CLL LSC P   +I  K V + W
Sbjct: 329 VNNMRKILSVSYYNLPPHLRACLLYLSCYPEDTNIGNKDVIWKW 372


>08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,
            3661975-3662133,3662193-3662243,3662838-3663018,
            3663102-3663228,3663322-3663431,3663529-3663667,
            3663767-3663876,3664002-3664071,3664247-3664320,
            3664458-3664553,3664682-3664777,3665041-3665168,
            3665422-3665656,3665743-3665910,3666274-3666381,
            3666468-3666617,3666905-3667015,3667118-3667297,
            3667427-3667555,3667819-3667914,3668108-3668293,
            3668431-3668603,3668720-3668921
          Length = 1150

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G + ST+Q    +V +VK  L+G    +  L+      +  +LV   A  QLC
Sbjct: 910  DNNIIAIGMEDSTIQIYNVRVDEVKSKLKGHSKKITGLAF---SQSMNMLVSSGADAQLC 966

Query: 322  IFS 330
             +S
Sbjct: 967  AWS 969


>02_03_0292 -
           17358129-17358213,17358462-17358541,17358627-17358797,
           17359440-17359541,17360216-17360365,17360549-17360671,
           17360781-17360867,17361209-17361289,17362071-17362210,
           17363490-17363534,17365315-17365485,17365784-17365805
          Length = 418

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -1

Query: 524 GCKSPIIVAYYNASTNFFKCLL 459
           G  +P+I A  N  T+F+KCLL
Sbjct: 191 GTVTPLITAANNGQTDFYKCLL 212


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,934,194
Number of Sequences: 37544
Number of extensions: 342360
Number of successful extensions: 854
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 841
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 854
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1851002996
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -