SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0058 + 17548945-17548947,17549234-17549281,17549618-175496...   136   2e-32
01_03_0277 + 14496298-14496300,14496875-14496952,14497061-144972...   132   3e-31
02_01_0047 - 316960-317397,317647-317744,317837-318017,318122-31...   131   6e-31
09_04_0672 + 19367940-19368203,19368307-19368399,19368711-19370078     31   0.84 
02_04_0117 + 19914704-19915830,19916575-19916860,19917047-19918258     29   3.4  
01_01_0703 - 5425713-5425862,5426302-5426451,5426853-5426964,542...    29   3.4  
12_02_0513 - 19906147-19906271,19906470-19906791,19907091-199076...    29   4.5  
08_02_0864 + 21994286-21994989,21996257-21996958,21997221-219973...    29   4.5  
02_01_0285 - 1913425-1914065,1914094-1914177,1914249-1915140,191...    28   6.0  

>05_04_0058 +
           17548945-17548947,17549234-17549281,17549618-17549695,
           17549952-17550132,17550223-17550320,17550827-17551258
          Length = 279

 Score =  136 bits (329), Expect = 2e-32
 Identities = 70/132 (53%), Positives = 82/132 (62%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDVVSI KT E FRL+YD KGRF +H I  E+AK+KLCKV+ V  G
Sbjct: 89  DGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKFKLCKVRSVQFG 148

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +P+L T+DGRTIRYPDPLIK        L+  ++        G  V        G  
Sbjct: 149 QKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGRNTGRV 208

Query: 615 APSCSRERHPGS 650
               SRE+H GS
Sbjct: 209 GVIKSREKHKGS 220



 Score =  118 bits (284), Expect = 4e-27
 Identities = 53/74 (71%), Positives = 61/74 (82%)
 Frame = +1

Query: 43  ARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEV 222
           ARG KKHLKRLNAP  WMLDKLGG +AP+PS+GPHK RECLPL++ LRNRLKYALT  EV
Sbjct: 18  ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV 77

Query: 223 LKIVKQRLIKVMGK 264
           + I+ QR + V GK
Sbjct: 78  ISILMQRHVMVDGK 91



 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 28/62 (45%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  ++ D+I++D+ T KI+DFIKF+ GN+ M+TGGRN GRVG I    +    F+ +H++
Sbjct: 168 PLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGRNTGRVGVIKSREKHKGSFETIHVE 227

Query: 671 DS 676
           D+
Sbjct: 228 DA 229


>01_03_0277 +
           14496298-14496300,14496875-14496952,14497061-14497241,
           14497348-14497445,14497542-14497979
          Length = 265

 Score =  132 bits (318), Expect = 3e-31
 Identities = 66/132 (50%), Positives = 81/132 (61%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDV+SI KT E +RL+YD KGRF +  +  E+AK+KLCKV+ V  G
Sbjct: 73  DGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +PYL T+DGRTIRYPDPLIK        L+  ++        G  V        G  
Sbjct: 133 QKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRV 192

Query: 615 APSCSRERHPGS 650
               +RE+H GS
Sbjct: 193 GVIKNREKHKGS 204



 Score =  120 bits (290), Expect = 8e-28
 Identities = 54/75 (72%), Positives = 63/75 (84%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPL++ +RNRLKYALT  E
Sbjct: 1   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V+ I+ QR + V GK
Sbjct: 61  VISILMQRHVLVDGK 75



 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 28/62 (45%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  ++ D+I++D+ T KI+DFIKF+ GN+ M+TGGRN GRVG I    +    F+ +H++
Sbjct: 152 PLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVE 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>02_01_0047 -
           316960-317397,317647-317744,317837-318017,318122-318199,
           319023-319025
          Length = 265

 Score =  131 bits (316), Expect = 6e-31
 Identities = 65/132 (49%), Positives = 81/132 (61%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDV+SI KT E +RL+YD KGRF +  +  E+AK+KLCKV+ V  G
Sbjct: 73  DGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +PYL T+DGRTIRYPDP+IK        L+  ++        G  V        G  
Sbjct: 133 QKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRV 192

Query: 615 APSCSRERHPGS 650
               +RE+H GS
Sbjct: 193 GVIKNREKHKGS 204



 Score =  120 bits (290), Expect = 8e-28
 Identities = 54/75 (72%), Positives = 63/75 (84%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPL++ +RNRLKYALT  E
Sbjct: 1   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V+ I+ QR + V GK
Sbjct: 61  VISILMQRHVLVDGK 75



 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 28/62 (45%), Positives = 44/62 (70%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  ++ D+I++D+ T KI+DFIKF+ GN+ M+TGGRN GRVG I    +    F+ +H++
Sbjct: 152 PIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVE 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>09_04_0672 + 19367940-19368203,19368307-19368399,19368711-19370078
          Length = 574

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = -3

Query: 184 SGKSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 83
           +G+SPG + RA  GD L V+VH       T++ W
Sbjct: 50  NGESPGPTIRAAQGDTLVVTVHNMLDTENTAIHW 83


>02_04_0117 + 19914704-19915830,19916575-19916860,19917047-19918258
          Length = 874

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/43 (39%), Positives = 22/43 (51%)
 Frame = -2

Query: 197 FRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKR 69
           F   L ++     +  L G   G+G Y PPSLSN   + AFKR
Sbjct: 35  FNVALNRLPASAGASPLLGHGHGVGVYYPPSLSNA-LVAAFKR 76


>01_01_0703 -
           5425713-5425862,5426302-5426451,5426853-5426964,
           5427120-5427481,5427578-5427712,5427812-5427889,
           5427989-5428174,5428266-5428452,5428552-5428658,
           5428732-5428806,5428885-5429040,5429165-5429437,
           5429548-5429643,5429724-5429814,5429883-5430385
          Length = 886

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +1

Query: 565 VRELVYDHGRP*LGACG-HHRVPARDIPALRHCAHQ 669
           V +LVYDHGR  + A G   RVPA    A     HQ
Sbjct: 95  VSQLVYDHGRHGVAAAGMMRRVPAFPPQAAAAAGHQ 130


>12_02_0513 -
           19906147-19906271,19906470-19906791,19907091-19907695,
           19908569-19908617
          Length = 366

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = -1

Query: 156 AQLVGTG*RSRCIHTAK-FVQHPCFGSV*ALQMLLRASR 43
           ++ V  G R+RC+H A   V+ P FG +    ++L ASR
Sbjct: 39  SRAVKAGRRARCVHHASALVRPPSFGRLAMFVLILSASR 77


>08_02_0864 + 21994286-21994989,21996257-21996958,21997221-21997374,
            21997494-21997838,21998323-21999240,21999312-21999640,
            21999709-21999832,21999901-22000071,22000188-22001648,
            22002647-22002910,22003866-22004189
          Length = 1831

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 81   SQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESS----EVCFDRKRSPENCETTP 245
            +QS+ V  + RCV  ETV + P + R+   G+F +       +  FD+  +  +CE  P
Sbjct: 894  NQSILVSLSSRCVWKETVCQRPHLLRIKYYGNFDKPLGRFLRDQLFDQNNNCISCELPP 952


>02_01_0285 -
           1913425-1914065,1914094-1914177,1914249-1915140,
           1915205-1915249,1915335-1915870,1915987-1916041
          Length = 750

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +3

Query: 333 FRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGP 437
           + LIYD++G   +  + P++A   L  ++ V T P
Sbjct: 147 YALIYDIQGSLALPILDPDDASSPLAVLELVTTAP 181


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,143,643
Number of Sequences: 37544
Number of extensions: 475312
Number of successful extensions: 1436
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1380
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1435
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1721314888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -