SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0684 - 18670697-18670933,18671003-18671102,18671214-186712...   123   1e-28
01_06_1828 - 40174446-40174543,40175031-40175171,40176518-401767...   116   2e-26
05_07_0063 - 27428056-27428184,27428321-27428460,27428698-274289...   109   1e-24
01_06_0270 + 28048449-28048577,28048915-28048978,28049537-280496...   104   5e-23
10_08_0977 - 21985149-21985277,21985348-21985722,21985824-219858...   103   9e-23
09_06_0370 - 22610441-22610569,22610659-22611060,22611141-226111...   103   9e-23
03_05_0902 + 28643395-28643708,28643830-28643921,28644342-286444...   100   8e-22
03_02_0434 + 8403630-8405666                                           58   4e-09
04_01_0166 - 1861750-1862181,1862317-1863873                           58   6e-09
08_02_0721 + 20401217-20401360,20401689-20401809,20401969-204020...    51   7e-07
02_05_0684 - 30880527-30880753,30881952-30882124,30882687-308827...    48   5e-06
06_01_0989 + 7672764-7672904,7673017-7673067,7673176-7673296,767...    48   8e-06
09_02_0586 + 10948079-10948283,10948506-10948615                       31   0.77 
12_02_0351 - 17829874-17830005,17830250-17830267,17830544-178306...    31   1.0  
12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139,398...    31   1.0  
07_03_1591 + 27967065-27967090,27967236-27968054,27984940-279850...    31   1.0  
07_01_0543 + 4008439-4008808,4009209-4009274,4009409-4009584           30   1.8  
01_05_0691 + 24330491-24332269                                         28   5.4  
02_05_0840 - 32118332-32118376,32118420-32118531,32119074-321191...    28   7.1  
01_05_0597 - 23526705-23526749,23526794-23526905,23527068-235271...    28   7.1  
06_01_0094 + 779097-779155,779882-781019,781732-782115,782842-78...    27   9.4  

>04_03_0684 -
           18670697-18670933,18671003-18671102,18671214-18671266,
           18671664-18671810,18671901-18672031,18673064-18673088,
           18673201-18673305,18673941-18674054,18674900-18674992,
           18675101-18675193,18675951-18676057,18676442-18676490,
           18677140-18677253,18677728-18677787,18677887-18677955,
           18679154-18679255,18679338-18679366,18679450-18679732,
           18680399-18680752
          Length = 754

 Score =  123 bits (297), Expect = 1e-28
 Identities = 57/93 (61%), Positives = 73/93 (78%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI Q+I+  SC+ILAVTPAN DLANSDAL+LAK  DP G RTIGVITKLD+MD GT
Sbjct: 171 RIRSMIMQYIKHPSCIILAVTPANADLANSDALQLAKLADPDGSRTIGVITKLDIMDRGT 230

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR+ L   ++PL+ GY+GVVNR ++ +   R+
Sbjct: 231 DARNFLLGNVIPLKLGYVGVVNRSQEDINFKRS 263



 Score =  101 bits (241), Expect = 6e-22
 Identities = 40/74 (54%), Positives = 59/74 (79%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH   ++F DF++++ EI+ ETD+  G NKG+S   I L+++SPNVL++TL+DLP
Sbjct: 95  EWGEFLHAPARRFHDFDQIKREIQLETDKEAGGNKGVSEKQIRLKIFSPNVLDITLVDLP 154

Query: 212 GLTKVPIGDQPIDI 253
           G+T+VP+GDQP DI
Sbjct: 155 GITRVPVGDQPSDI 168



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI+ ++ +  ALA E KFF + P+Y  L    G
Sbjct: 255 QEDINFKRSVKDALAFEEKFFSTLPAYHGLTHCCG 289


>01_06_1828 -
           40174446-40174543,40175031-40175171,40176518-40176719,
           40176815-40176914,40177029-40177081,40177951-40178097,
           40178184-40178341,40178509-40178599,40179415-40179522,
           40179815-40179952,40180154-40180246,40180342-40180434,
           40180528-40180637,40181087-40181135,40181324-40181437,
           40181530-40181589,40181674-40181742,40182034-40182135,
           40182235-40182263,40182348-40182630,40183574-40183960
          Length = 874

 Score =  116 bits (279), Expect = 2e-26
 Identities = 51/88 (57%), Positives = 71/88 (80%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI  +I+ ++C+ILAV+PAN DL+NSDAL++A+  DP G RTIGVITKLD+MD GT
Sbjct: 182 RIRTMILSYIKHKTCIILAVSPANADLSNSDALQIARNADPDGSRTIGVITKLDIMDRGT 241

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTL 522
           DAR+ L   ++PLR GY+GVVNR ++ +
Sbjct: 242 DARNFLLGNVIPLRLGYVGVVNRSQQDI 269



 Score =  113 bits (272), Expect = 1e-25
 Identities = 48/74 (64%), Positives = 60/74 (81%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ EFLH  G++F DF E+R EI+AETDR  G NKG+S   I L++YSPNVLN+TL+DLP
Sbjct: 106 EWGEFLHLPGRRFYDFREIRREIQAETDREAGGNKGVSDKQIRLKIYSPNVLNITLVDLP 165

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP DI
Sbjct: 166 GITKVPVGDQPTDI 179



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI     I  ALA E  FF +HP+Y  LA   G
Sbjct: 266 QQDIKSDLSIKEALAREESFFRNHPAYNGLAQYCG 300


>05_07_0063 -
           27428056-27428184,27428321-27428460,27428698-27428926,
           27429231-27429281,27429411-27429636,27430230-27430300,
           27430466-27430585,27430671-27430865,27431088-27431152,
           27431232-27431322,27431607-27431707,27431767-27431817,
           27432076-27432177,27432406-27432510,27432600-27432663,
           27433023-27433151
          Length = 622

 Score =  109 bits (263), Expect = 1e-24
 Identities = 49/89 (55%), Positives = 71/89 (79%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q I+ M+  FI + +C+ILAV+PAN DLA SDA+K+++EVDP+G RT GV+TK+DLMD+G
Sbjct: 172 QDIENMVRSFIEKPNCIILAVSPANQDLATSDAIKISREVDPKGERTFGVLTKIDLMDKG 231

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           TDA D+LE +   L++ +IGVVNR ++ +
Sbjct: 232 TDAVDILEGRSYRLQQQWIGVVNRSQQDI 260



 Score =  103 bits (248), Expect = 9e-23
 Identities = 50/76 (65%), Positives = 59/76 (77%)
 Frame = +2

Query: 17  INGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLT 196
           I+G+ EYAEF+H   K+FTDF  VR EI  ETDR TG +K IS VPI+L +YSPNV+NLT
Sbjct: 79  IDGDREYAEFMHLPRKRFTDFALVRKEIADETDRETGRSKQISSVPIHLSIYSPNVVNLT 138

Query: 197 LIDLPGLTKVPIGDQP 244
           LIDLPGLTKV +G  P
Sbjct: 139 LIDLPGLTKVAVGPFP 154



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/36 (44%), Positives = 25/36 (69%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+   D+ AA   ER++F + P Y+HLA R+G+
Sbjct: 257 QQDINKNVDMIAARRREREYFSTTPEYKHLAHRMGS 292


>01_06_0270 +
           28048449-28048577,28048915-28048978,28049537-28049638,
           28049971-28050021,28050075-28050172,28050395-28050485,
           28050718-28050782,28050913-28051107,28051207-28051326,
           28051592-28051662,28051787-28052012,28052330-28052407,
           28052507-28052735,28052958-28053097,28053571-28053699
          Length = 595

 Score =  104 bits (250), Expect = 5e-23
 Identities = 47/89 (52%), Positives = 70/89 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q I+ M+  FI + +C+ILA++PAN DLA SDA+K+++EVDP+G RT GV+TK+DLMD+G
Sbjct: 136 QDIETMVRSFIEKPNCIILAISPANQDLATSDAIKISREVDPKGERTFGVLTKIDLMDKG 195

Query: 436 TDARDVLENKLLPLRRGYIGVVNRCRKTL 522
           T+A D+LE +   L+  +IGVVNR ++ +
Sbjct: 196 TNAVDMLEGRSYRLQYPWIGVVNRSQQDI 224



 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 34/49 (69%), Positives = 39/49 (79%)
 Frame = +2

Query: 86  VRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPI 232
           VR EI  ET+R TG  K ISPVPI L +YSPNV++LTLIDLPGLTKV +
Sbjct: 67  VRKEIADETERATGHKKQISPVPIYLSIYSPNVVDLTLIDLPGLTKVAV 115



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q+DI+   D+ AA   ER++F +   Y++LA R+G+
Sbjct: 221 QQDINKSVDMIAARHIEREYFANTTEYKYLAHRMGS 256


>10_08_0977 -
           21985149-21985277,21985348-21985722,21985824-21985874,
           21985964-21986189,21986289-21986359,21986430-21986549,
           21986641-21986835,21986921-21986985,21987894-21987984,
           21988700-21988761,21988854-21988904,21989172-21989273,
           21989873-21989980,21990071-21990134,21990246-21990392
          Length = 618

 Score =  103 bits (248), Expect = 9e-23
 Identities = 45/84 (53%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q I+ M+  ++ + +C+ILA++PAN D+A SDA+KLA++VDP G RT GV+TKLDLMD+G
Sbjct: 166 QDIENMVRSYVDKPNCIILAISPANQDIATSDAIKLARDVDPTGERTFGVLTKLDLMDKG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A DVLE +   L+  ++G+VNR
Sbjct: 226 TNALDVLEGRSYRLQHPWVGIVNR 249



 Score =  102 bits (244), Expect = 3e-22
 Identities = 49/78 (62%), Positives = 59/78 (75%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           +G  EYAEFLH   ++F DF  VR EI+ ETDR+TG  K ISPVPI+L +YSP+V+NLTL
Sbjct: 87  DGVQEYAEFLHMPKRRFNDFALVRKEIQDETDRLTGKTKQISPVPIHLSIYSPHVVNLTL 146

Query: 200 IDLPGLTKVPIGDQPIDI 253
           IDLPGLTKV +  QP  I
Sbjct: 147 IDLPGLTKVAVEGQPESI 164



 Score = 34.7 bits (76), Expect = 0.062
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+  A   E++FF S P Y HL+ R+G+
Sbjct: 251 QADINKNIDMIIARRKEQEFFASSPEYSHLSSRMGS 286


>09_06_0370 -
           22610441-22610569,22610659-22611060,22611141-22611191,
           22611475-22611700,22612219-22612289,22612411-22612530,
           22612618-22612812,22612995-22613059,22613306-22613396,
           22613611-22613672,22613796-22613846,22614326-22614427,
           22614876-22614939,22615104-22615247
          Length = 590

 Score =  103 bits (248), Expect = 9e-23
 Identities = 45/82 (54%), Positives = 65/82 (79%)
 Frame = +1

Query: 262 IKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTD 441
           I+ M+  ++ + +C+ILA++PAN D+A SDA+KL+KEVDP G RT GV+TKLDLMD+GT+
Sbjct: 131 IENMVRSYVEKPNCIILAISPANQDIATSDAIKLSKEVDPSGERTFGVLTKLDLMDKGTN 190

Query: 442 ARDVLENKLLPLRRGYIGVVNR 507
           A DVLE +   L+  ++G+VNR
Sbjct: 191 ALDVLEGRAYRLQYPWVGIVNR 212



 Score = 81.8 bits (193), Expect = 4e-16
 Identities = 39/53 (73%), Positives = 43/53 (81%)
 Frame = +2

Query: 86  VRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQP 244
           VR EI  ETDRVTG  K ISPVPI+L +YSPNV+NLTLIDLPGLTKV +  QP
Sbjct: 72  VRQEIADETDRVTGKTKQISPVPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQP 124



 Score = 35.9 bits (79), Expect = 0.027
 Identities = 15/42 (35%), Positives = 26/42 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGTLTTASV 635
           Q DI+ + D+  A   ER++F + P Y HLA ++G++  A +
Sbjct: 214 QADINRKVDMIVAREKEREYFENSPDYAHLASKMGSVYLAKL 255


>03_05_0902 +
           28643395-28643708,28643830-28643921,28644342-28644443,
           28645135-28645185,28645267-28645328,28645664-28645754,
           28645911-28645975,28646053-28646247,28646346-28646465,
           28646630-28646700,28646839-28647064,28647474-28647524,
           28647629-28647857,28648140-28648279,28648527-28648652
          Length = 644

 Score =  100 bits (240), Expect = 8e-22
 Identities = 47/73 (64%), Positives = 55/73 (75%)
 Frame = +2

Query: 23  GNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLI 202
           G  EYAEFLH   K+FTDF  VR EI  ETDR+TG  K IS +PI+L +YSP+V+NLTLI
Sbjct: 117 GGQEYAEFLHAPRKRFTDFAAVRKEIADETDRITGKTKAISNIPIHLSIYSPHVVNLTLI 176

Query: 203 DLPGLTKVPIGDQ 241
           DLPGLTKV +  Q
Sbjct: 177 DLPGLTKVAVEGQ 189



 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 44/84 (52%), Positives = 65/84 (77%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q I+ M+  ++ + + +ILA++PAN D+A SDA+KLA++VDP G RT GV+TKLDLMD+G
Sbjct: 195 QDIENMVRSYVDKPNSIILAISPANQDIATSDAIKLARDVDPSGDRTFGVLTKLDLMDKG 254

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A DVLE +   L+  ++G+VNR
Sbjct: 255 TNAVDVLEGRQYRLQHPWVGIVNR 278



 Score = 34.3 bits (75), Expect = 0.082
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q DI+   D+ AA   E+++F S P Y HLA ++G
Sbjct: 280 QADINRNVDMLAARRKEKEYFESSPDYGHLAHKMG 314


>03_02_0434 + 8403630-8405666
          Length = 678

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 29/57 (50%), Positives = 36/57 (63%)
 Frame = +2

Query: 83  EVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           +V   I A T  + GS KGIS  PI L V    V +LTL+DLPG+T+VP+  QP DI
Sbjct: 134 KVADAINAATAEIAGSGKGISDAPITLVVRKRGVPDLTLVDLPGITRVPVQGQPDDI 190



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/83 (31%), Positives = 47/83 (56%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI  +I ++I  +  +IL V  A  D    ++++++++VD  G RT+ V+TK D   EG 
Sbjct: 193 QIAKIIKEYIAPKESIILNVLSATVDFPTCESIRMSQQVDRTGERTLAVVTKADKAPEGL 252

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
             +  +++  + L  GY+ V NR
Sbjct: 253 LEKVTMDDVNIGL--GYVCVRNR 273


>04_01_0166 - 1861750-1862181,1862317-1863873
          Length = 662

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 29/57 (50%), Positives = 35/57 (61%)
 Frame = +2

Query: 83  EVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPIDI 253
           EV   I A T  + G  KGIS  PI L V    V +LTL+DLPG+T+VP+  QP DI
Sbjct: 99  EVADAINAATAEIAGCGKGISNAPITLVVRKKGVPDLTLVDLPGITRVPVKGQPEDI 155



 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 27/83 (32%), Positives = 46/83 (55%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI G+I  +I     +IL V  A  D    ++++++++VD  G RT+ V+TK D   EG 
Sbjct: 158 QIAGIIKAYIAPRESIILNVLSATVDFPTCESIRMSQQVDRTGNRTLAVVTKSDKAPEGL 217

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
             +  +++  + L  GY+ V NR
Sbjct: 218 LEKVTVDDVRIGL--GYVCVRNR 238


>08_02_0721 +
           20401217-20401360,20401689-20401809,20401969-20402067,
           20402790-20402851,20403680-20403797,20404004-20404343,
           20404435-20404582,20405043-20405144,20405240-20405359,
           20405812-20405895,20405974-20406101,20408314-20408389,
           20408556-20408631,20408800-20408876,20408975-20409031,
           20409411-20409555,20409634-20409806,20409928-20410054,
           20410090-20410192,20410492-20410688,20410946-20411097
          Length = 882

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 2/80 (2%)
 Frame = +1

Query: 253 RQQIKGMIFQFIRRESCLILAVTPA--NTDLANSDALKLAKEVDPQGLRTIGVITKLDLM 426
           R   + MI  +  R   ++L + PA    D+A+S AL++A+E+D +G RTIGV++K+D +
Sbjct: 136 RSMDESMIGNYAARNDAILLVIVPALQAPDVASSRALRIARELDSEGSRTIGVVSKVDQV 195

Query: 427 DEGTDARDVLENKLLPLRRG 486
            E  D R +L  + L + +G
Sbjct: 196 AE--DQRALLAVQALLVNQG 213


>02_05_0684 -
           30880527-30880753,30881952-30882124,30882687-30882754,
           30882860-30882973,30883281-30883438,30883516-30883654,
           30883851-30883907,30884064-30884140,30884324-30884462,
           30884590-30884668,30885047-30885174,30885269-30885352,
           30886072-30886191,30886274-30886375,30886470-30886617,
           30887404-30887749,30887851-30887968,30888309-30888370,
           30888798-30888947,30889049-30889169,30889269-30889319,
           30889427-30889567
          Length = 933

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 2/62 (3%)
 Frame = +1

Query: 274 IFQFIRRESCLILAVTPAN--TDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAR 447
           I ++      +++ V PA    D+A+S AL+LAK++DP G RTIGV++K+D      DA+
Sbjct: 176 ISEYAGHNDAILIVVIPAMQAADVASSRALRLAKDIDPDGTRTIGVLSKID--QASADAK 233

Query: 448 DV 453
            V
Sbjct: 234 TV 235


>06_01_0989 +
           7672764-7672904,7673017-7673067,7673176-7673296,
           7673406-7673510,7673963-7674024,7674398-7674515,
           7674596-7674932,7675389-7675536,7675632-7675733,
           7675824-7675943,7676436-7676519,7676622-7676749,
           7677351-7677435,7677566-7677713,7677971-7678047,
           7678187-7678243,7678423-7678561,7678642-7678796,
           7679003-7679116,7679208-7679275,7679830-7679996,
           7680245-7680453
          Length = 911

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 27/63 (42%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPAN--TDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDA 444
           MI ++      ++L V PA    D+A+S AL+LAK++D  G RT+GVI+K+D   EG DA
Sbjct: 160 MINEYAGHNDAILLVVIPAMQAADVASSRALRLAKDIDADGTRTVGVISKVD-QAEG-DA 217

Query: 445 RDV 453
           + +
Sbjct: 218 KTI 220


>09_02_0586 + 10948079-10948283,10948506-10948615
          Length = 104

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +3

Query: 267 RDDIPVHQTRIMPYPGSYSGQHGFGQQRCSEACQRSRPTRIAYY 398
           +DD    +  ++PYPG    Q G   ++C + C R+ P +  YY
Sbjct: 50  KDDSTACRVDVVPYPGH---QQGLALRQCGQ-CDRTGPPKYVYY 89


>12_02_0351 -
           17829874-17830005,17830250-17830267,17830544-17830672,
           17831037-17831336,17831447-17831675,17831762-17831989,
           17832380-17832645
          Length = 433

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 4/51 (7%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNK----GISPVPINLRVY 172
           +Y + LHC   +FTD +++  E      ++  S K    GI+ +P+++  Y
Sbjct: 224 DYVDILHCHDIEFTDLDQIVNETIPVLQKIKESGKARFIGITGLPLSIYTY 274


>12_01_0503 -
           3981603-3981730,3982858-3983023,3983057-3983139,
           3983250-3983301,3983497-3983654,3983756-3985617,
           3986029-3986093,3986176-3986340,3986836-3986893,
           3987479-3987590,3987661-3987712,3988080-3988140,
           3988220-3988377,3988705-3988787,3988897-3988945,
           3989122-3989185,3990225-3990317,3990410-3990543,
           3991364-3991585,3991815-3991937,3992103-3992267,
           3993064-3993450
          Length = 1479

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +2

Query: 83  EVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGL 217
           +++  IEAE  R+       S   I +R+   +  NLT+ID PGL
Sbjct: 127 DIQAYIEAENMRLENDPSQFSEKEIIIRIEYKHCPNLTIIDTPGL 171



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = +1

Query: 286 IRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLD 420
           I+ +  +IL +   + D +N+   ++  +VDP   RT+ V TKLD
Sbjct: 198 IKHKETIILCLEDCS-DWSNATTRRVVMQVDPDLARTVLVSTKLD 241


>07_03_1591 +
           27967065-27967090,27967236-27968054,27984940-27985022,
           27985590-27985744,27985956-27986461,27986551-27986703,
           27987146-27987485,27987558-27987822,27987897-27988634,
           27989734-27989779,27989849-27990223,27991511-27991567,
           27991640-27992438
          Length = 1453

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +3

Query: 309 PGSYSGQH-GFGQQRCSEACQRSRPTRIAYYRRNNKIR 419
           P + SG H G  +  C +AC+ + P +   YR ++K+R
Sbjct: 329 PSTPSGSHEGVDRPPCVQACEMNTPEKDRVYRHDSKLR 366


>07_01_0543 + 4008439-4008808,4009209-4009274,4009409-4009584
          Length = 203

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/44 (31%), Positives = 28/44 (63%)
 Frame = -3

Query: 159 LIGTGDIPLLEPVTRSVSASISPRTSLKSVNFFPLQCKNSAYSV 28
           L+ TG++PL  P+ R+++ ++    +  SV   PLQCK+++  +
Sbjct: 89  LVLTGNVPLGIPINRTLAVTLPKACNSMSV---PLQCKDTSAQI 129


>01_05_0691 + 24330491-24332269
          Length = 592

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = -2

Query: 184 HIRGINTQVNRYRRYTLVGTSNTICLRLDL 95
           H  G+   +  YRR T+V T + IC+ L L
Sbjct: 458 HFAGLPYLIGMYRRATMVATGSGICVFLSL 487


>02_05_0840 -
           32118332-32118376,32118420-32118531,32119074-32119196,
           32119267-32119379,32119460-32119605,32120048-32120162,
           32120360-32120473
          Length = 255

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +1

Query: 382 QGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRC 510
           Q L     + K+D +  G +A D+ E  LL + RG I  ++RC
Sbjct: 125 QALDRGAALLKVDKIVTGHNADDIAETVLLNILRGDIARLSRC 167


>01_05_0597 -
           23526705-23526749,23526794-23526905,23527068-23527134,
           23527439-23527566,23527638-23527750,23527827-23527972,
           23528419-23528525,23528667-23528873,23530878-23531129,
           23531324-23531406
          Length = 419

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +1

Query: 382 QGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRC 510
           Q L     + K+D +  G +A D+ E  LL + RG I  ++RC
Sbjct: 265 QALDRGAALLKVDKIVTGHNADDIAETVLLNILRGDIARLSRC 307


>06_01_0094 +
           779097-779155,779882-781019,781732-782115,782842-783060
          Length = 599

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = -3

Query: 159 LIGTGDIPLLEPVTRSVSASISPRTSLK 76
           LI +GD+PL+    R  ++S +P T +K
Sbjct: 423 LISSGDLPLISSAVRWTASSRTPSTPIK 450


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,762,119
Number of Sequences: 37544
Number of extensions: 332796
Number of successful extensions: 824
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 795
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 824
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -