SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0290 + 2246791-2247027,2248089-2248346                           97   8e-21
10_08_0310 - 16669565-16669822,16670558-16670794                       94   5e-20
06_03_1007 + 26869731-26870429,26871262-26871387                       29   1.8  
01_06_1794 - 39919363-39920025                                         29   1.8  
11_06_0187 - 21029511-21029857,21031444-21031739,21032270-210323...    29   2.3  
08_01_0283 - 2304024-2304111,2304224-2304343,2304594-2304715,230...    29   2.3  
07_03_1182 - 24610862-24611637,24612223-24612340,24612441-246141...    29   2.3  
02_04_0461 - 23125260-23125868                                         29   3.1  
01_01_0167 + 1422344-1424260,1424338-1424472,1424568-1424990,142...    29   3.1  
09_02_0307 + 7131031-7131326,7131414-7131560,7132579-7132711,713...    28   4.1  
05_03_0549 - 15349259-15349346,15349466-15349585,15349899-153500...    28   4.1  
03_06_0467 + 34145126-34145187,34145403-34145759,34146161-341462...    28   5.4  
02_05_0026 + 25168944-25168991,25169114-25169179,25169414-25169599     28   5.4  
09_02_0308 + 7137099-7137132,7137495-7137611,7138252-7138319,713...    27   7.1  
03_06_0140 + 31951569-31951710,31951943-31952037,31952141-319539...    27   7.1  
09_02_0487 + 9828283-9829354,9830436-9830580,9830863-9831153,983...    27   9.4  
08_02_0830 - 21617485-21618198                                         27   9.4  
06_01_0056 - 478424-478491,478587-478821,478916-478978,479102-47...    27   9.4  

>03_01_0290 + 2246791-2247027,2248089-2248346
          Length = 164

 Score = 97.1 bits (231), Expect = 8e-21
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 1/106 (0%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           GL  R + L    FR  G IPL+TY++ YK+GD VD++ NGAV KGMPHK YHG+TGRV+
Sbjct: 6   GLRARTRDLFARPFRKKGYIPLTTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVW 65

Query: 219 NVTAHALGVIVNSVFAEGLYRS-ASISVLSMSSTPSADKTSLRESK 353
           NVT  A+GV +N      + R    + V  +  +   ++  LR+ K
Sbjct: 66  NVTKRAIGVEINKQVGNRIIRKRIHVRVEHVQPSRCTEELRLRKIK 111



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 34/84 (40%), Positives = 53/84 (63%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  ++V  RII KRI++RVEHV+ S+C ++   R  +N++L  +AKA G+ ++ KRQP  
Sbjct: 75  EINKQVGNRIIRKRIHVRVEHVQPSRCTEELRLRKIKNDQLKADAKARGEVISTKRQPEG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGATLET-VTPIPYDVV 157


>10_08_0310 - 16669565-16669822,16670558-16670794
          Length = 164

 Score = 94.3 bits (224), Expect = 5e-20
 Identities = 42/81 (51%), Positives = 55/81 (67%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           GL  R + L    FR  G IPL+TY++ YK+G+ VD++ NGAV KGMPHK YHG+TGRV+
Sbjct: 6   GLRARTRDLFARPFRKKGYIPLTTYLRTYKIGEHVDVKVNGAVHKGMPHKFYHGRTGRVW 65

Query: 219 NVTAHALGVIVNSVFAEGLYR 281
           NVT  A+GV +N      + R
Sbjct: 66  NVTKRAIGVEINKQVGNRIIR 86



 Score = 72.5 bits (170), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 54/84 (64%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  ++V  RII KRI++RVEHV+ S+C ++F  R  +N++L  +AKA G+ ++ KRQP  
Sbjct: 75  EINKQVGNRIIRKRIHVRVEHVQPSRCTEEFRLRKIKNDQLKADAKARGEVISTKRQPQG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGATLET-VTPIPYDVV 157


>06_03_1007 + 26869731-26870429,26871262-26871387
          Length = 274

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +3

Query: 243 VIVNSVFAEGLYRSASISVLSMSSTPSADKTSLRESKRMRGY*RKPRLPARP 398
           V+V  V  E  Y S + +  S S   +AD      +   RG  R+PR  ARP
Sbjct: 54  VVVVEVEEEEGYESGASAASSTSCVSTADSDVAASAAARRGRRRRPRAAARP 105


>01_06_1794 - 39919363-39920025
          Length = 220

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 15/46 (32%), Positives = 21/46 (45%)
 Frame = +2

Query: 344 RVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPI 481
           R ++ ++   EA AAG   + KRQP PP      SG       A +
Sbjct: 27  RQQQQQQQQYEAAAAGDKTSAKRQPPPPSRLKKTSGRNDDAATAAV 72


>11_06_0187 -
           21029511-21029857,21031444-21031739,21032270-21032345,
           21032714-21032836,21033200-21033228,21033823-21034328
          Length = 458

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 3/90 (3%)
 Frame = +2

Query: 149 QRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSKCR 328
           +R+W   +G A  S+P +   R Q          QQ+   + + K++ +    V   + +
Sbjct: 87  KRKW---EGQANGSVPGESSGRQQ----------QQKPEEKRVAKQVKVETPDVDAKQLK 133

Query: 329 QDFLKRVK---ENERLLKEAKAAGKTVNLK 409
             FLK VK   EN    K  +A GK   LK
Sbjct: 134 SSFLKMVKLMNENAEQKKNYRANGKISQLK 163


>08_01_0283 -
           2304024-2304111,2304224-2304343,2304594-2304715,
           2304824-2305096,2305454-2305558,2305635-2305851,
           2306012-2306262,2306518-2306724,2307087-2307351,
           2308655-2308749
          Length = 580

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 131 WRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCS 232
           W    H  QW     YAT+ I W+ R+ V  D S
Sbjct: 535 WISIGHSTQWLWYSVYATKQISWRTRALVISDWS 568


>07_03_1182 -
           24610862-24611637,24612223-24612340,24612441-24614120,
           24614253-24614320,24615370-24615550
          Length = 940

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +2

Query: 182 TQSIPWKDRSRVQRDCSCSRC-DCQQRVRGRIIPKRINIRVEHVKHSKCRQDF 337
           T+S PW+ + ++      S+C D + R R   +   I  R   ++  +C +DF
Sbjct: 382 TESAPWRQQEKIATSSKASQCRDAEVRPRTASLYAYIERRGGGLEFLECNKDF 434


>02_04_0461 - 23125260-23125868
          Length = 202

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 23/103 (22%), Positives = 46/103 (44%), Gaps = 3/103 (2%)
 Frame = +2

Query: 197 WKD-RSRVQRDCSCSR--CDCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERL 367
           WK+ R+R     + SR     +QR R + + +    RV  +K    +    KR +  ER 
Sbjct: 82  WKEARTRRASALAASRKPTPLEQRARDKSLKRAYQARVAELKEEIRQSKAAKRKQREERE 141

Query: 368 LKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYEFV 496
            ++ +   ++    ++   PK    ++ ++K   L  +P EF+
Sbjct: 142 KRKKENVLRSGTKLQRVTNPKTIQKIAKSKKRKQLKVVPDEFL 184


>01_01_0167 +
           1422344-1424260,1424338-1424472,1424568-1424990,
           1425183-1425252,1425356-1425495,1425620-1425679,
           1425776-1425931,1426272-1426541
          Length = 1056

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 123 YKVGDIVDIRGNGAVQKGMPHKVY 194
           ++ GDI+ I G+G+V K  PH++Y
Sbjct: 623 FEDGDIIVIWGDGSVSKVGPHEIY 646


>09_02_0307 +
           7131031-7131326,7131414-7131560,7132579-7132711,
           7133115-7133207,7133421-7133717
          Length = 321

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = +2

Query: 371 KEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYEFVA 499
           ++A AA +   L+      + A    G E+P  L P+PYE+ A
Sbjct: 77  RKAAAAAEADALRSAARQARTASSWYGDERPRWLGPVPYEYPA 119


>05_03_0549 -
           15349259-15349346,15349466-15349585,15349899-15350020,
           15350511-15350783,15351398-15351502,15351588-15351804,
           15352031-15352281,15352582-15352776,15352881-15353139,
           15354617-15354714
          Length = 575

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 11/32 (34%), Positives = 14/32 (43%)
 Frame = +2

Query: 131 WRHCRHQRQWCSSKGYATQSIPWKDRSRVQRD 226
           W H  H  QW     YA++   W+ R  V  D
Sbjct: 530 WIHVGHSTQWLWYSVYASKQFSWRTRMLVVSD 561


>03_06_0467 +
           34145126-34145187,34145403-34145759,34146161-34146248,
           34146361-34146506,34146892-34146936,34147030-34147133,
           34147225-34147361,34147651-34147761,34148455-34148664
          Length = 419

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +3

Query: 378 PRLPARPST*RDSQLPLKLPTSSVELRNPSYLRLSH 485
           P L  RP   R    P+  PT + +++ PS+L L H
Sbjct: 347 PNLQERPMDRRPELGPMPFPTQAWQMQAPSHLPLLH 382


>02_05_0026 + 25168944-25168991,25169114-25169179,25169414-25169599
          Length = 99

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = +2

Query: 308 VKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQ 415
           ++ +KCRQD++  VK++ +L+++  A  K    KRQ
Sbjct: 1   MRQAKCRQDYMAIVKQSRQLIEKLDA--KNEPKKRQ 34


>09_02_0308 +
           7137099-7137132,7137495-7137611,7138252-7138319,
           7138413-7138538,7138650-7139619,7139641-7139737,
           7140026-7140113,7140336-7140396,7140425-7140447,
           7140663-7140776,7141193-7141306,7144731-7144825,
           7146506-7146824,7147166-7147309,7147463-7147564,
           7147868-7147971,7148121-7148247,7148804-7148845,
           7148939-7149091,7149326-7149426,7149807-7150227
          Length = 1139

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = +3

Query: 51  RHQGLVRSQFRT-HGTIPLSTYMKVYKVGDIVDIR 152
           RH  L+R  F     TIP+ T ++VY+V D+  +R
Sbjct: 543 RHNSLLRGIFMDGKTTIPVYTVLEVYRVSDMELVR 577


>03_06_0140 +
           31951569-31951710,31951943-31952037,31952141-31953982,
           31954065-31954179,31954260-31954897
          Length = 943

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 273 LYRSASISVLSMSSTPSADKTSLRESKRM 359
           +Y+SA++ V + SS P+ADK + +  ++M
Sbjct: 410 VYKSANLQVSNSSSIPAADKQTRQTMRQM 438


>09_02_0487 +
           9828283-9829354,9830436-9830580,9830863-9831153,
           9831984-9832032
          Length = 518

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +2

Query: 347 VKENERLLKEAKAA--GKTVNLKRQPAPPKAAH-IVSGTEKPVLLAP 478
           V+ +++ LK  +A   G   N  R P PP+A++ I  G   P+LL+P
Sbjct: 93  VQPSKKFLKSLEACIPGNCTN-GRLPTPPQASNDIEEGANMPLLLSP 138


>08_02_0830 - 21617485-21618198
          Length = 237

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +2

Query: 317 SKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAA 436
           S CR D ++R   N+R L  A +A +  ++ ++P P K A
Sbjct: 149 SPCRADSVERWDSNKRPLSRASSAERW-DINKKPRPKKDA 187


>06_01_0056 -
           478424-478491,478587-478821,478916-478978,479102-479179,
           479263-479354,479788-479866,479971-480104,480184-480523
          Length = 362

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 78  FRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALG 242
           F T G IP       Y+ G  + +  +G  + G PHK+      R+Y++ + ALG
Sbjct: 110 FSTEGEIP-------YREGQSIGVIADGVDKNGKPHKL------RLYSIASSALG 151


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,585,713
Number of Sequences: 37544
Number of extensions: 299847
Number of successful extensions: 1008
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 991
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1008
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1178343540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -