SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0558 - 4880811-4880996,4881098-4881178,4881247-4881393,488...    31   0.65 
08_02_1053 - 23968372-23968442,23969245-23969294,23970396-239704...    30   1.1  
12_02_0772 - 23029703-23029715,23029835-23030463,23030637-230316...    29   2.0  
07_03_0504 - 18842442-18844668,18845418-18845428                       29   2.6  
04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,962...    29   3.5  
02_01_0267 - 1766071-1766261,1766368-1766569,1766719-1766814,176...    29   3.5  
01_01_0100 - 755894-756662,757086-757598,758718-761050                 29   3.5  
09_04_0086 + 14445665-14446683,14448669-14448915                       28   4.6  
09_04_0085 + 14441123-14443507,14443731-14443787                       28   4.6  
08_02_1424 + 26982502-26983572,26984129-26984908,26988299-26990128     28   4.6  
08_02_0003 + 11180421-11180757,11180773-11185715                       28   4.6  
08_01_0483 - 4243963-4244019,4244243-4245797,4246335-4246651           28   4.6  
07_01_0376 + 2815419-2815755,2815912-2817659                           28   4.6  
02_02_0233 + 8105765-8107840                                           28   4.6  
09_01_0095 - 1403586-1403987,1406687-1406722,1406995-1407012,140...    28   6.1  
07_03_0944 + 22787933-22789906                                         28   6.1  
03_06_0204 + 32341756-32341843,32341943-32342025,32342690-323427...    28   6.1  
04_04_0639 + 26883810-26883821,26884131-26884307,26885276-268853...    27   8.0  

>05_01_0558 -
           4880811-4880996,4881098-4881178,4881247-4881393,
           4881985-4882029,4882370-4883134
          Length = 407

 Score = 31.1 bits (67), Expect = 0.65
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +3

Query: 306 RPLVDLRNPGPPQHQEHETQNPEHHEDAEK 395
           RPL  L +P PP  Q  ET+  E  +++E+
Sbjct: 98  RPLPSLASPPPPTQQPQETEEQEQQQESEE 127


>08_02_1053 -
           23968372-23968442,23969245-23969294,23970396-23970457,
           23970527-23970709,23970737-23970901,23972235-23972408
          Length = 234

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +3

Query: 372 EHHEDA-EKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSRPACNISKKIS 548
           E H+D   K V   +ND           + E+ +   KW+A  EQ+  S    N+S KIS
Sbjct: 123 ESHDDLMAKTVKIYENDFKDGPFLFMHCWNELKNQ-PKWHAYLEQLDKSNKRKNVSHKIS 181


>12_02_0772 -
           23029703-23029715,23029835-23030463,23030637-23031673,
           23031830-23032166
          Length = 671

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 11/44 (25%), Positives = 23/44 (52%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    + E ID+   I ++D  L   +K+ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKNEDIDELEDIAEVDKQLERYQKDTL 53


>07_03_0504 - 18842442-18844668,18845418-18845428
          Length = 745

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 345 HQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQIKSSR 518
           H E +  + E+HED   I+  +   +  A IAL  G  +  +  G+W    E +KS +
Sbjct: 186 HMEVQNLDLENHED--DIIFQITGGLPLA-IALLSGLMKTKESTGEWQKVFEYLKSKQ 240


>04_03_0024 -
           9623178-9624001,9624502-9624678,9625144-9625305,
           9625520-9626032,9626801-9629153
          Length = 1342

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 10/44 (22%), Positives = 24/44 (54%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    ++E ID+   I ++D  L   +++ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKKEDIDELEDIAEVDKQLERYQRDTL 53


>02_01_0267 -
           1766071-1766261,1766368-1766569,1766719-1766814,
           1767414-1767560,1767635-1767800,1767907-1767973,
           1772850-1772949,1773029-1773099,1773199-1773382,
           1773784-1773929,1774484-1774663,1774737-1774824,
           1775634-1775838,1775945-1776081,1776529-1776612,
           1776718-1776894,1777050-1777194,1777642-1777763,
           1777846-1778091,1778571-1778789,1779016-1779094,
           1779178-1779257,1779291-1779320
          Length = 1053

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 24/93 (25%), Positives = 45/93 (48%)
 Frame = +1

Query: 82  VPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPSLRV 261
           +  A+ K L++ +  S EQEL    +++ D+   L+AN   + +  +K  +EE+K   R 
Sbjct: 673 ISSADSKTLSL-EAESKEQELNSSKSSLDDLTAMLKANVDAINNFTIK--IEELKRQ-RD 728

Query: 262 I*KTLKCRMKMRKSRGL*SI*EIPGPRSIKSTK 360
             KTL+  +      G   + ++   RS+   K
Sbjct: 729 NLKTLEANLDQTVRDGAKDLEQLMSSRSMHLAK 761


>01_01_0100 - 755894-756662,757086-757598,758718-761050
          Length = 1204

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 10/44 (22%), Positives = 24/44 (54%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    ++E ID+   I ++D  L   +++ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKKEDIDELEDIAEVDKQLERYQRDTL 53


>09_04_0086 + 14445665-14446683,14448669-14448915
          Length = 421

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 10/44 (22%), Positives = 23/44 (52%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    + E ID+   I ++D  L   +++ +
Sbjct: 351 RIASRDDKSLSCIDKQKGKNEDIDELEDIAEVDKQLERYQRDTL 394


>09_04_0085 + 14441123-14443507,14443731-14443787
          Length = 813

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 10/44 (22%), Positives = 23/44 (52%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    + E ID+   I ++D  L   +++ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKNEDIDELEDIAEVDKQLERYQRDTL 53


>08_02_1424 + 26982502-26983572,26984129-26984908,26988299-26990128
          Length = 1226

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = +1

Query: 139 ELIDQANTIKDIDNSLRANK-KEVIDIPVKVIVEEIKPSLRVI 264
           EL+     I DID + RA K +E +D+ VK+I  + +  LRVI
Sbjct: 149 ELLQSTAAIDDIDEARRAAKQQEKVDL-VKLITNDGQGGLRVI 190


>08_02_0003 + 11180421-11180757,11180773-11185715
          Length = 1759

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 10/44 (22%), Positives = 23/44 (52%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    + E ID+   I ++D  L   +++ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKNEDIDELEDIAEVDKQLERYQRDTL 53


>08_01_0483 - 4243963-4244019,4244243-4245797,4246335-4246651
          Length = 642

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 10/44 (22%), Positives = 23/44 (52%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    + E ID+   I ++D  L   +++ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKNEDIDELEDIAEVDKQLERYQRDTL 53


>07_01_0376 + 2815419-2815755,2815912-2817659
          Length = 694

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 10/44 (22%), Positives = 23/44 (52%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVI 210
           ++   +DK L+ +D    + E ID+   I ++D  L   +++ +
Sbjct: 10  RIASRDDKSLSCIDKQKGKNEDIDELEDIAEVDKQLERYQRDTL 53


>02_02_0233 + 8105765-8107840
          Length = 691

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
 Frame = +3

Query: 372 EHHEDAEKIVSSVKNDINTAEIALRQ--GFQEVSDGIGKWYARTEQ 503
           EH     KI+  ++ D+ +  ++LR     +  +D  G W  R EQ
Sbjct: 426 EHRSSTAKIIGFIRKDLTSGWVSLRSVADHRRFNDRRGHWTLRREQ 471


>09_01_0095 -
           1403586-1403987,1406687-1406722,1406995-1407012,
           1407331-1407513
          Length = 212

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 31  C*LYSCSPH-AQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKD 171
           C  Y C+P  A  A  +++  A ++P+ +VDN + E+  + Q N + D
Sbjct: 66  CSAYRCNPQLAIGARDEEISMAPEEPV-LVDNNNQEENSLQQLNLLAD 112


>07_03_0944 + 22787933-22789906
          Length = 657

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 3/39 (7%)
 Frame = +3

Query: 414 NDINTAEIALRQGFQE---VSDGIGKWYARTEQIKSSRP 521
           +D++    AL +G +E   ++DG+G WY R++  ++  P
Sbjct: 34  DDVDGLRGALAEGGEEAAELADGVGLWYGRSKAYEARTP 72


>03_06_0204 +
           32341756-32341843,32341943-32342025,32342690-32342765,
           32342876-32342943,32343001-32343045,32343308-32343392,
           32344270-32344385,32344497-32344580,32345394-32345540,
           32345845-32345956,32346027-32346146,32346338-32346411
          Length = 365

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +3

Query: 345 HQEHETQNPEHH---EDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWY 488
           H+  + Q  + H   EDAEK+V SVK  +   E     G  +V    G ++
Sbjct: 152 HEHEDEQKKQEHTFNEDAEKMVKSVKQAMENGEGCRVYGVLDVQRVAGNFH 202


>04_04_0639 +
           26883810-26883821,26884131-26884307,26885276-26885339,
           26886614-26887734,26888193-26888481,26888528-26888658,
           26888910-26889133,26889220-26889286,26889744-26889803,
           26889896-26889979,26890290-26890301
          Length = 746

 Score = 27.5 bits (58), Expect = 8.0
 Identities = 14/47 (29%), Positives = 23/47 (48%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE 392
           V S + N+ +P+ N+   RP      P PPQ Q+H+ +      + E
Sbjct: 345 VLSLMLNLRLPN-NDAPPRPPAQSTPPPPPQQQQHQPETKAREPEPE 390


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,062,731
Number of Sequences: 37544
Number of extensions: 242603
Number of successful extensions: 1068
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1034
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1064
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1328870592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -