SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0540 + 9340379-9340592,9341250-9342988                          187   9e-48
05_05_0109 - 22454539-22456268,22457069-22457279                      121   5e-28
03_02_0546 - 9381989-9383733,9385838-9386054                          121   5e-28
01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229    118   5e-27
03_06_0484 + 34233042-34233258,34235317-34237049                      118   7e-27
11_08_0075 + 28173220-28173433,28175348-28177083                      116   2e-26
02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84...   105   3e-23
03_05_0877 + 28443481-28443538,28443641-28443911,28444028-284442...   104   7e-23
08_01_0654 - 5639419-5641449                                          100   2e-21
05_04_0392 - 20889699-20891726                                        100   2e-21
12_02_0825 + 23476943-23476952,23477263-23477328,23477737-234778...    99   3e-21
03_02_0542 - 9348126-9349585,9352433-9352655                           99   4e-21
05_04_0052 - 17515344-17517353                                         95   4e-20
11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,443...    91   1e-18
01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819     91   1e-18
11_01_0564 - 4447078-4448519,4449465-4449711                           88   6e-18
12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231           87   1e-17
05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906...    87   1e-17
03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74...    81   9e-16
02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090...    81   9e-16
11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836           79   4e-15
01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165     75   6e-14
12_01_0346 + 2652181-2653566                                           58   1e-08
02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728...    56   4e-08
05_01_0550 + 4820086-4821255,4822112-4822321,4822429-4822524,482...    53   3e-07
01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937,425...    50   1e-06
05_07_0320 + 29235266-29235305,29235409-29236682                       44   1e-04
06_03_1137 + 27903012-27904196,27904330-27904542,27905775-279058...    43   2e-04
06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575...    41   0.001
03_02_0180 - 6211823-6213559                                           36   0.026
09_04_0565 + 18580292-18580571,18582823-18583052                       31   0.98 
04_03_0694 + 18781776-18781994,18782475-18782648,18782743-187830...    30   1.7  
04_04_1042 - 30346132-30346285,30346629-30346759,30346867-303469...    29   3.0  
08_02_1261 + 25689487-25689666,25690642-25690887,25691032-256911...    29   3.9  
06_03_0953 - 26277946-26278800,26280177-26280676,26280735-26280849     29   3.9  
01_07_0278 - 42440405-42440515,42440765-42440830,42440995-424410...    29   3.9  
10_01_0121 - 1493822-1494316                                           28   6.9  
11_06_0370 + 22768977-22769523,22769619-22770642,22770784-227711...    28   9.1  
03_04_0025 - 16557328-16557851,16558000-16558123,16558518-165586...    28   9.1  

>03_02_0540 + 9340379-9340592,9341250-9342988
          Length = 650

 Score =  187 bits (455), Expect = 9e-48
 Identities = 121/236 (51%), Positives = 145/236 (61%), Gaps = 14/236 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN       
Sbjct: 8   PAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN------- 60

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSS-CQ*WRQT*DQGSI*G*RQNLFPRGSQFHGA 440
            Q +M  +++   +K L+ +    T + S  + W      G        +  +G +   +
Sbjct: 61  -QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFS 119

Query: 441 YENEGNCRSLSWQNCAECSYHGS----------AYFNDSQRQATKDAGTISGLNVLRIIN 590
            E   +      +  AE +Y GS          AYFNDSQRQATKDAG ISGLNV+RIIN
Sbjct: 120 AEEISSMVLNKMKETAE-AYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIIN 178

Query: 591 EPTAAAIAYGLDKKGT--GERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           EPTAAAIAYGLDKK +  GE+NVLIFDLGGGT     L         +   GDTHL
Sbjct: 179 EPTAAAIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 234



 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 39/57 (68%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+   G KP I V YKGE+K F  EE+SSMVL KMKETAEAYLG TV+NAV+TVP
Sbjct: 95  FKVLPGPGDKPMIGVQYKGEEKQFSAEEISSMVLNKMKETAEAYLGSTVKNAVVTVP 151



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F D +VQ+D K WPF++
Sbjct: 65  NPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKV 97


>05_05_0109 - 22454539-22456268,22457069-22457279
          Length = 646

 Score =  121 bits (292), Expect = 5e-28
 Identities = 55/62 (88%), Positives = 59/62 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 
Sbjct: 5   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 64

Query: 258 PT 263
           PT
Sbjct: 65  PT 66



 Score =  109 bits (261), Expect = 3e-24
 Identities = 58/83 (69%), Positives = 62/83 (74%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT 
Sbjct: 151 AYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSSGEKNVLIFDLGGGTF 210

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 211 DVSLLTIEEGIFEVKATAGDTHL 233



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV   G KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG +++NAV+TVP
Sbjct: 94  FKVVPGPGDKPMIVVQYKGEEKQFAAEEISSMVLIKMREIAEAYLGSSIKNAVVTVP 150



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 22/33 (66%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F D +VQ+DMK WPF++
Sbjct: 64  NPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKV 96


>03_02_0546 - 9381989-9383733,9385838-9386054
          Length = 653

 Score =  121 bits (292), Expect = 5e-28
 Identities = 55/62 (88%), Positives = 59/62 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 66

Query: 258 PT 263
           PT
Sbjct: 67  PT 68



 Score =  110 bits (264), Expect = 1e-24
 Identities = 59/83 (71%), Positives = 62/83 (74%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK   TGE+NVLIFDLGGGT 
Sbjct: 153 AYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAASTGEKNVLIFDLGGGTF 212

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 213 DVSILTIEEGIFEVKATAGDTHL 235



 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 37/57 (64%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV     KP I V YKGE+K F  EE+SSMVLTKMKE AEA+L  T++NAVITVP
Sbjct: 96  FKVVPGPADKPMIVVTYKGEEKKFSAEEISSMVLTKMKEIAEAFLSTTIKNAVITVP 152



 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 23/33 (69%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F D +VQADMK WPF++
Sbjct: 66  NPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKV 98


>01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229
          Length = 841

 Score =  118 bits (284), Expect = 5e-27
 Identities = 56/66 (84%), Positives = 61/66 (92%), Gaps = 2/66 (3%)
 Frame = +3

Query: 69  KMAKA--PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +MAK   PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct: 193 EMAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 252

Query: 243 QVAMTP 260
           QVAM P
Sbjct: 253 QVAMNP 258



 Score =  109 bits (261), Expect = 3e-24
 Identities = 58/83 (69%), Positives = 62/83 (74%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT 
Sbjct: 344 AYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSSGEKNVLIFDLGGGTF 403

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 404 DVSLLTIEEGIFEVKATAGDTHL 426



 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V+   G KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG  ++NAV+TVP
Sbjct: 287 FKVIPGPGDKPMIVVQYKGEEKQFSAEEISSMVLIKMREIAEAYLGSNIKNAVVTVP 343



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 22/33 (66%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F D +VQ+DMK WPF++
Sbjct: 257 NPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKV 289


>03_06_0484 + 34233042-34233258,34235317-34237049
          Length = 649

 Score =  118 bits (283), Expect = 7e-27
 Identities = 53/61 (86%), Positives = 57/61 (93%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVAM 
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN 66

Query: 258 P 260
           P
Sbjct: 67  P 67



 Score =  109 bits (261), Expect = 3e-24
 Identities = 58/83 (69%), Positives = 62/83 (74%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT 
Sbjct: 153 AYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTF 212

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 213 DVSLLTIEEGIFEVKATAGDTHL 235



 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 35/50 (70%), Positives = 40/50 (80%)
 Frame = +1

Query: 361 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           G KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG TV+NAV+TVP
Sbjct: 103 GDKPMIVVQYKGEEKQFSAEEISSMVLIKMREIAEAYLGSTVKNAVVTVP 152



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 21/33 (63%), Positives = 30/33 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F DA+VQ+D+K WP+++
Sbjct: 66  NPINTVFDAKRLIGRRFSDASVQSDIKMWPYKV 98


>11_08_0075 + 28173220-28173433,28175348-28177083
          Length = 649

 Score =  116 bits (279), Expect = 2e-26
 Identities = 52/61 (85%), Positives = 57/61 (93%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMN 65

Query: 258 P 260
           P
Sbjct: 66  P 66



 Score =  109 bits (261), Expect = 3e-24
 Identities = 58/83 (69%), Positives = 62/83 (74%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT 
Sbjct: 152 AYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTF 211

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 212 DVSLLTIEEGIFEVKATAGDTHL 234



 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 36/57 (63%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++  G KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG T++NAV+TVP
Sbjct: 95  FKVIAGPGDKPMIVVQYKGEEKQFAAEEISSMVLIKMREIAEAYLGTTIKNAVVTVP 151



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 22/33 (66%), Positives = 30/33 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F DA+VQ+D+K WPF++
Sbjct: 65  NPINTVFDAKRLIGRRFSDASVQSDIKLWPFKV 97


>02_01_0112 -
           839048-839552,839638-839720,839828-839982,840078-840557,
           840855-841097,841189-841403,841489-841756,842477-842525
          Length = 665

 Score =  105 bits (253), Expect = 3e-23
 Identities = 55/81 (67%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGT   
Sbjct: 178 AYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTFDV 236

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 237 SILTIDNGVFEVLATNGDTHL 257



 Score =  101 bits (243), Expect = 5e-22
 Identities = 45/57 (78%), Positives = 53/57 (92%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFTD+ERLIG+AAKNQ A+ P
Sbjct: 36  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNP 92



 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 35/57 (61%), Positives = 46/57 (80%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++V+  GKP I+V  K GE+K F PEEVS+M+L KMKETAEAYLGK + +AV+TVP
Sbjct: 121 YKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVP 177



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/51 (50%), Positives = 33/51 (64%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P  TIFD KRLIGRKFED  VQ DMK  P+++     N   + +I+VK K
Sbjct: 91  NPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI----VNKDGKPYIQVKIK 137


>03_05_0877 +
           28443481-28443538,28443641-28443911,28444028-28444242,
           28444329-28445057,28445143-28445297,28445384-28445965
          Length = 669

 Score =  104 bits (250), Expect = 7e-23
 Identities = 44/64 (68%), Positives = 55/64 (85%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           +  K P +GIDLGTTYSCVGV+++G V+I+ANDQGNR TPS+VAFTD ERL+G+AAKNQ 
Sbjct: 33  RKTKGPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQA 92

Query: 249 AMTP 260
           A+ P
Sbjct: 93  ALNP 96



 Score =  103 bits (247), Expect = 2e-22
 Identities = 55/82 (67%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGTST 686
           AYFND+QRQATKDAGTI+GLNV RIINEPTAAAIAYGLD+KG GE  NVL++DLGGGT  
Sbjct: 182 AYFNDAQRQATKDAGTIAGLNVPRIINEPTAAAIAYGLDRKGAGEMTNVLVYDLGGGTFD 241

Query: 687 CPSLP-SRRYLRGEIHRGDTHL 749
              L             GDTHL
Sbjct: 242 VSVLSLDHGVFEVLATSGDTHL 263



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 35/59 (59%), Positives = 46/59 (77%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L ++VV  GGKP ++V  K GE K F PEE+S+M+L KMKETAE+YLG+ V +AV+TVP
Sbjct: 123 LPYKVVDKGGKPYVEVRVKAGEVKVFSPEEISAMILAKMKETAESYLGQRVTDAVVTVP 181



 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK---TKPFSPRK 424
           +P+ TIFD KRLIGR+F+D  VQ D+K+ P++  V++   +    +RVK    K FSP +
Sbjct: 95  NPDRTIFDIKRLIGRRFDDEEVQRDVKYLPYK--VVDKGGKPYVEVRVKAGEVKVFSPEE 152


>08_01_0654 - 5639419-5641449
          Length = 676

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 53/81 (65%), Positives = 58/81 (71%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V RIINEPTAAAIAYG+DKKG  E+NVL+FDLGGGT   
Sbjct: 190 AYFNDAQRQATKDAGVIAGLTVDRIINEPTAAAIAYGIDKKG-AEKNVLVFDLGGGTFDV 248

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 249 SILAIDNGVFEVLATNGDTHL 269



 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 45/58 (77%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 36/59 (61%), Positives = 44/59 (74%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F VV   GKP ++V  K G+ + F PEEVS+MVLT+MKETAEAYLG+ V  AV+TVP
Sbjct: 131 LPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAMVLTRMKETAEAYLGEKVTRAVVTVP 189



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P  TI+DAKRLIGR+F DA VQ DMK  PF  +V++ N   + H+RV+ K
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPF--AVVDRN--GKPHVRVEVK 149


>05_04_0392 - 20889699-20891726
          Length = 675

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 53/81 (65%), Positives = 58/81 (71%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL V RIINEPTAAAIAYG+DKKG  E+NVL+FDLGGGT   
Sbjct: 190 AYFNDAQRQATKDAGVIAGLTVDRIINEPTAAAIAYGIDKKG-AEKNVLVFDLGGGTFDV 248

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L             GDTHL
Sbjct: 249 SILAIDNGVFEVLATNGDTHL 269



 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 36/59 (61%), Positives = 44/59 (74%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F VV   GKP ++V  K G+ + F PEEVS+MVLT+MKETAEAYLG+ V  AV+TVP
Sbjct: 131 LPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAMVLTRMKETAEAYLGEKVTRAVVTVP 189



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P  TI+DAKRLIGR+F DA VQ DMK  PF  +V++ N   + H+RV+ K
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPF--AVVDRN--GKPHVRVEVK 149


>12_02_0825 +
           23476943-23476952,23477263-23477328,23477737-23477885,
           23478148-23478212,23479247-23479710,23479724-23480208
          Length = 412

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 58/82 (70%), Positives = 62/82 (75%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFN SQRQATKDA  I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGGT 
Sbjct: 182 AYFNYSQRQATKDARVIAGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGGTF 241

Query: 684 TCPSLPSRRYLRGEIHRGDTHL 749
              SL     L  E   GDTHL
Sbjct: 242 DV-SL-----LTIEEGAGDTHL 257



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++  G K  I V YKGE+K F  EE+SSMVL KM+E AEAYLG T++ AV+TVP
Sbjct: 125 FKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVLIKMREIAEAYLGTTIKKAVVTVP 181



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/30 (60%), Positives = 25/30 (83%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           N   +AKRLIGR+F DA+VQ+D+K WPF++
Sbjct: 22  NMAENAKRLIGRRFTDASVQSDIKLWPFKV 51



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/26 (61%), Positives = 23/26 (88%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEL 352
           DAKRLIG++F DA+VQ+D+  WPF++
Sbjct: 102 DAKRLIGQRFTDASVQSDIMLWPFKV 127


>03_02_0542 - 9348126-9349585,9352433-9352655
          Length = 560

 Score = 98.7 bits (235), Expect = 4e-21
 Identities = 46/59 (77%), Positives = 50/59 (84%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PAVGIDLGTTYSCV V++ G+VE+I NDQGN TTPS VAFTDT RLIGDAA NQ AM P
Sbjct: 11  PAVGIDLGTTYSCVAVWRRGRVEVIPNDQGNLTTPSCVAFTDTWRLIGDAALNQAAMNP 69



 Score = 88.6 bits (210), Expect = 5e-18
 Identities = 43/59 (72%), Positives = 49/59 (83%), Gaps = 3/59 (5%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK---KGTGERNVLIFDLGGGT 680
           YFNDSQRQAT DAG ++GL+VLRIINEPTAAA+AYGLDK       ++ VLIFDLGGGT
Sbjct: 156 YFNDSQRQATMDAGAVAGLDVLRIINEPTAAAVAYGLDKVVGSSDKKKRVLIFDLGGGT 214



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V S    +P I V Y+GE+K F  EE+S+MVL KMKETAEAYL KTV+ AVITVP
Sbjct: 98  FKVTSGKDDRPMIVVQYRGEEKEFSAEEISAMVLFKMKETAEAYLDKTVEKAVITVP 154



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 22/34 (64%), Positives = 29/34 (85%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P NTIFDAKRLIGR+F D +VQ D+K WPF+++
Sbjct: 68  NPLNTIFDAKRLIGRRFSDVSVQGDIKLWPFKVT 101


>05_04_0052 - 17515344-17517353
          Length = 669

 Score = 95.5 bits (227), Expect = 4e-20
 Identities = 43/57 (75%), Positives = 51/57 (89%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQATKDA TI+GL V RI+NEPTAAA+AYG+ K+G G +NVL+FDLGGGT
Sbjct: 185 AYFNDAQRQATKDAATIAGLAVERILNEPTAAALAYGVGKEGAGGKNVLVFDLGGGT 241



 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 44/58 (75%), Positives = 50/58 (86%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFT   ERLIG+AAKNQ A  P
Sbjct: 42  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAANP 99



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGED-KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L F VV  GGKP ++V  +G D +   PEEVS+MVL +MKETAEAYLG+ V  AV+TVP
Sbjct: 126 LPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVSAMVLARMKETAEAYLGEEVTRAVVTVP 184



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/51 (45%), Positives = 35/51 (68%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P  T++DAKRLIGR+F DA VQ DM+  PF  +V++     + H+RV+ +
Sbjct: 98  NPGRTVYDAKRLIGRRFADAEVQRDMRLLPF--AVVDKG--GKPHVRVEVR 144


>11_01_0563 +
           4423609-4423846,4424671-4426132,4428949-4429364,
           4430555-4432052,4432199-4432217,4432469-4432675,
           4432814-4433065
          Length = 1363

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 39/60 (65%), Positives = 47/60 (78%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSC  V +H + E+I NDQGNR TPS VAFT  +R +GDAA+NQ A+ PT
Sbjct: 642 PAIGIDLGTTYSCAAVRRHNRSEVITNDQGNRITPSCVAFTADDRFVGDAAENQAALNPT 701



 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 39/60 (65%), Positives = 46/60 (76%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCV V +  + E I NDQGNR TPS VAFT  +R +GDAA+NQ A+ PT
Sbjct: 16  PAIGIDLGTTYSCVAVRRRYRSEAITNDQGNRITPSCVAFTAADRFVGDAAENQAALNPT 75



 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 42/60 (70%), Positives = 49/60 (81%), Gaps = 4/60 (6%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNVLIFDLGGGT 680
           YFN++QR+AT DA TI+GLNV+RIINEP+AAA+AYGLDK     G   R VLIFDLGGGT
Sbjct: 161 YFNNAQREATLDAATIAGLNVMRIINEPSAAALAYGLDKMPPASGGAGRMVLIFDLGGGT 220



 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 42/64 (65%), Positives = 48/64 (75%), Gaps = 8/64 (12%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--------GTGERNVLIFDL 668
           YFN++QR+AT DA  I+GLNV+RIINEP+AAAIAYGLDK         G   R VLIFDL
Sbjct: 787 YFNNAQREATLDAAAIAGLNVMRIINEPSAAAIAYGLDKMPPPPASGGGAAVRTVLIFDL 846

Query: 669 GGGT 680
           GGGT
Sbjct: 847 GGGT 850



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++    +P I V ++G++K F PEE+S+MVL+K+++ A AYLG+ V +AVITVP
Sbjct: 103 FKVIAGRDDRPTIVVRHEGKEKQFVPEEISAMVLSKLRDAAVAYLGEPVTDAVITVP 159



 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV+    +P I V ++G++  F PEE+S+MVL+K+++ A AYLG+ V +AVITVP
Sbjct: 729 FKVVAGPDDRPTIVVQHEGKEMQFVPEEISAMVLSKLRDAAVAYLGEPVTDAVITVP 785



 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIF+ KRLIGR+F D +VQ D+K WPF++
Sbjct: 73  NPTNTIFEVKRLIGRRFSDKSVQEDIKLWPFKV 105



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIF+AKRLIGR+F   +VQ D+K WPF++
Sbjct: 699 NPTNTIFEAKRLIGRRFSSKSVQEDIKLWPFKV 731


>01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819
          Length = 539

 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 38/60 (63%), Positives = 47/60 (78%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           P +GIDLGT  SCV V+Q+G+ EI+ N+ G R TPSY AFTDTERL+GDAAK+Q +  PT
Sbjct: 10  PVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDTERLVGDAAKSQASRNPT 69



 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTS 519
           F+VV   G KP +  +YKG+ K    EEV+SM+L+KMK  AEAY+G  V+NAV+TVP + 
Sbjct: 97  FKVVPGRGDKPMVAASYKGKQKLLAAEEVASMLLSKMKAEAEAYIGGPVKNAVVTVPASF 156

Query: 520 MTLKDKPQK 546
             L+ +  K
Sbjct: 157 DVLQRRATK 165



 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG-TST 686
           A F+  QR+ATK A  ++GL+VL +I+ P AAA+A+G+ +   G++NVL+FDLGGG TS 
Sbjct: 154 ASFDVLQRRATKHACAVAGLDVLGVIHGPAAAAVAFGIHEI-AGDKNVLVFDLGGGHTSV 212

Query: 687 CPSLPSRRYLRGEIHRGDTHL 749
                +   +      GD HL
Sbjct: 213 SLLAVASGKIAVRATAGDPHL 233



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/33 (54%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+F  KRL+GR+F DA+VQ  +K WPF++
Sbjct: 67  NPTNTVFATKRLMGRRFSDASVQDGLKLWPFKV 99


>11_01_0564 - 4447078-4448519,4449465-4449711
          Length = 562

 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVAMT 257
           PAVGIDLGTTYSCV V++H + E+IANDQGNR TPS VAFT  D +  +GDAA NQ A+ 
Sbjct: 17  PAVGIDLGTTYSCVAVWRHDRGEVIANDQGNRLTPSCVAFTADDDDSFVGDAAFNQSALN 76

Query: 258 PT 263
           PT
Sbjct: 77  PT 78



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 41/58 (70%), Positives = 48/58 (82%), Gaps = 2/58 (3%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE--RNVLIFDLGGGT 680
           YFN++QRQAT DAG I+GLNV+RIINEPTAAA+AYGL+K       R VL+FDLGGGT
Sbjct: 164 YFNNAQRQATMDAGAIAGLNVMRIINEPTAAALAYGLEKMPVSNKGRMVLVFDLGGGT 221



 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 36/57 (63%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV+    +P I V ++GE++ F PEE+SSMVL KM+ETAE YLGKTV NAVITVP
Sbjct: 106 FKVVAGQEDRPMIVVRHEGEERQFMPEEISSMVLAKMRETAEVYLGKTVTNAVITVP 162



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIF+ KRLIGR+F D +VQ D+K WPF++
Sbjct: 76  NPTNTIFEVKRLIGRRFSDDSVQKDIKLWPFKV 108


>12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231
          Length = 270

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 41/57 (71%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDLGGGT
Sbjct: 193 AYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDLGGGT 247



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 245
           ++A    VGIDLGTT S V   + GK  +I N +G RTTPS VA+T   ERL+G  AK Q
Sbjct: 47  RVACEKVVGIDLGTTNSAVAAMEGGKPTVITNAEGQRTTPSVVAYTKGGERLVGQIAKRQ 106

Query: 246 VAMTPTTQY 272
             + P   +
Sbjct: 107 AVVNPENTF 115



 Score = 35.9 bits (79), Expect = 0.034
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++ VV D     +K+      K F  EE+S+ VL K+ + A  +L   +  AV+TVP
Sbjct: 136 VSYHVVRDDNG-NVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLNDKITKAVVTVP 192


>05_03_0397 +
           13488642-13488941,13489711-13489963,13490594-13490673,
           13491251-13491393,13491512-13491610,13491785-13491974,
           13492504-13492902,13492993-13493400
          Length = 623

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 41/57 (71%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDLGGGT
Sbjct: 126 AYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDLGGGT 180



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +3

Query: 141 GKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPTTQY 272
           GK  I+ N +G RTTPS VA+T + +RL+G  AK Q  + P   +
Sbjct: 4   GKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTF 48



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++RV+ D     +K+      K F  EE+S+ VL K+ + A  +L   V  AVITVP
Sbjct: 69  VSYRVIRDDNG-NVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLNDKVTKAVITVP 125


>03_01_0093 -
           745434-746057,746492-747112,747222-747791,747870-747948,
           748258-748331,748385-748387
          Length = 656

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG + K   E  + +FDLGGGT   
Sbjct: 175 AYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTNNK---EGLIAVFDLGGGTFDV 231

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L  S      +   GDT L
Sbjct: 232 SILEISNGVFEVKATNGDTFL 252



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + P ++ + VLTKMKETAE+YLGK+V  AVITVP
Sbjct: 137 DGKQYSPSQIGAFVLTKMKETAESYLGKSVSKAVITVP 174



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT F  KRLIGR+F+D   Q +MK  P+++
Sbjct: 91  NPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYKI 123


>02_05_0916 -
           32706039-32706332,32707483-32708103,32708450-32709070,
           32709183-32709752,32709840-32709918,32710002-32710075,
           32711336-32711398
          Length = 773

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG + K   E  + +FDLGGGT   
Sbjct: 195 AYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTNNK---EGLIAVFDLGGGTFDV 251

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L  S      +   GDT L
Sbjct: 252 SILEISNGVFEVKATNGDTFL 272



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPTT 266
           +GIDLGTT SCV V +    ++I N +G RTTPS VAF    ERL+G  AK Q    P  
Sbjct: 55  IGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGERLVGTPAKRQAVTNPQN 114

Query: 267 QY 272
            +
Sbjct: 115 TF 116



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 24/38 (63%), Positives = 30/38 (78%)
 Frame = +1

Query: 397 EDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + K + P ++ + VLTKMKETAE+YLGKTV  AVITVP
Sbjct: 157 DGKQYSPSQIGAFVLTKMKETAESYLGKTVSKAVITVP 194



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT F  KRLIGR+FED   Q +MK  P+++
Sbjct: 111 NPQNTFFGTKRLIGRRFEDPQTQKEMKMVPYKI 143


>11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836
          Length = 526

 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 41/63 (65%), Positives = 47/63 (74%), Gaps = 7/63 (11%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-------KGTGERNVLIFDLG 671
           YFN++QR+AT DA  I+GLNV+RIINEP+AAAIAYGLDK            R VLIFDLG
Sbjct: 97  YFNNAQREATLDAAAIAGLNVMRIINEPSAAAIAYGLDKMPPPASGADAAGRTVLIFDLG 156

Query: 672 GGT 680
           GGT
Sbjct: 157 GGT 159



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/57 (47%), Positives = 42/57 (73%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+V++    +P I V ++G++  F PEEVS+MVL+K+++ A AYL + V +AVITVP
Sbjct: 39  FKVIAGPDDRPTIVVQHEGKEMQFVPEEVSAMVLSKLRDAAVAYLSEPVTDAVITVP 95



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/26 (61%), Positives = 22/26 (84%)
 Frame = +2

Query: 275 DAKRLIGRKFEDATVQADMKHWPFEL 352
           +AKRLIGR+F D +VQ D+K WPF++
Sbjct: 16  EAKRLIGRRFSDKSVQEDIKLWPFKV 41


>01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165
          Length = 648

 Score = 74.9 bits (176), Expect = 6e-14
 Identities = 32/54 (59%), Positives = 44/54 (81%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGG 674
           YFND+QR+A  DAG I+GL+V+RI++EP AAA+AYGLD   +  + V++FDLGG
Sbjct: 182 YFNDAQRRAISDAGDIAGLDVMRIVSEPIAAAVAYGLDNVRSNGKRVVVFDLGG 235



 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD--TERLIGDAAKNQVAMTP 260
           +GID+G TYSCV V+  G+VEII NDQG+R TPS+VAFTD     ++G+AAK Q   +P
Sbjct: 37  LGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSP 95



 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKV-AYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L + VV   GKP + V A  G+ +   PEE+++ VL KMK+TAEA+LG+TV +AV+ VP
Sbjct: 122 LPYAVVDMEGKPHVLVEAADGDVRVLSPEEIAAAVLAKMKKTAEAHLGRTVSSAVVAVP 180


>12_01_0346 + 2652181-2653566
          Length = 461

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGTSTC 689
           YF+D  R+A  +A  ++GL  +RII+EPTAAA+++GL      +  NVL+  +GGGTS  
Sbjct: 187 YFSDGPREAAMNAARMAGLTTVRIIDEPTAAAVSHGLHHGRLRDGGNVLVLHVGGGTSAA 246

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L            R D HL
Sbjct: 247 TVLTYDNAVFEAVASRHDAHL 267



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 3/42 (7%)
 Frame = +1

Query: 394 GEDKTFFPEEVSSMVLTKMKETAEAYL---GKTVQNAVITVP 510
           G  ++ +  +V+SMV+ ++K  AEA L   GK V NAV+TVP
Sbjct: 144 GAARSVYASDVASMVIAELKARAEARLAGGGKKVHNAVVTVP 185



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA 251
           + +DLG T SCV  +     E  A        P+ VAFT D + L+G+AAKN  A
Sbjct: 47  IAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKNHPA 98


>02_05_0491 +
           29470575-29471351,29471574-29471806,29472697-29472856,
           29473149-29473394,29473492-29473628,29473874-29474207,
           29474283-29474444,29474717-29474791,29474866-29474966,
           29475042-29475111,29475210-29475266,29475357-29475418,
           29475505-29475577,29475663-29475884
          Length = 902

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 24/58 (41%), Positives = 40/58 (68%), Gaps = 1/58 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGTS 683
           YF  ++R+A   A  ++G+NVL +INE   AA+ YG+DK  + E R+V+ +D+G G++
Sbjct: 177 YFGQAERRALTQAAQLAGVNVLALINEHAGAALQYGIDKDFSNESRHVIFYDMGAGST 234



 Score = 29.5 bits (63), Expect = 3.0
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +1

Query: 385 AYKGED-KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           A + +D + +  EE+ +MVL      A+A++G  V++AV+ VP
Sbjct: 133 AVRADDGQVYTVEEIVAMVLHYAAGLADAHVGAPVRDAVVAVP 175


>05_01_0550 +
           4820086-4821255,4822112-4822321,4822429-4822524,
           4822610-4822828,4823201-4823395,4823466-4823612,
           4823712-4823861,4825015-4825145,4825234-4825477
          Length = 853

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 659
           +C     AYF D QR+A  DA  I+GL  LR+ +E TA A+AYG+ K    E+   NV  
Sbjct: 139 DCCIGIPAYFTDLQRRAVADAAAIAGLRPLRLFHETTATALAYGIYKTDLPEKEWLNVAF 198

Query: 660 FDLG 671
            D+G
Sbjct: 199 IDVG 202



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G     V V +   ++++ N++  R TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNPRNS 63

Query: 270 YS 275
            S
Sbjct: 64  VS 65



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +1

Query: 352 VSDG--GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           VS+G  G P +   Y GED+ F P ++ +MVL+ +K  AE  L   V +  I +P
Sbjct: 91  VSEGPDGFPLVHARYLGEDRAFTPTQLLAMVLSNLKGIAEGNLNAAVFDCCIGIP 145



 Score = 36.3 bits (80), Expect = 0.026
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P N++   KRL+GR F D  +Q D+  +PF +S
Sbjct: 59  NPRNSVSQIKRLLGRAFADPELQRDLASFPFRVS 92


>01_01_0573 +
           4253484-4254653,4255526-4255735,4255842-4255937,
           4256034-4256255,4256829-4257023,4257097-4257243,
           4257323-4257472,4257762-4257892,4257978-4258194
          Length = 845

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 659
           +C      YF D QR+A  DA TI+GL  LR+ +E TA A+AYG+ K    E    NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLCPLRLFHETTATALAYGIYKTDLPENDQLNVAF 198

Query: 660 FDLG 671
            D+G
Sbjct: 199 VDVG 202



 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG DLG     V V +   ++++ N++  R TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNPKNS 63

Query: 270 YS 275
            S
Sbjct: 64  VS 65



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +1

Query: 334 ALAFRVVSDG--GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITV 507
           A  FRV S+G  G P +   Y GE++ F P ++ +MVL+ +K  AE+ L   V +  I +
Sbjct: 86  AFPFRV-SEGPDGFPLVHARYLGEERVFTPTQLMAMVLSNLKGIAESNLNTAVVDCCIGI 144

Query: 508 P 510
           P
Sbjct: 145 P 145



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P N++   KRL+GRK+ D  +Q D+  +PF +S
Sbjct: 59  NPKNSVSQIKRLLGRKYSDPELQRDIAAFPFRVS 92


>05_07_0320 + 29235266-29235305,29235409-29236682
          Length = 437

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 17/34 (50%), Positives = 26/34 (76%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F PE+V+ +++  +K TAEA+LG  + NAV+TVP
Sbjct: 153 FLPEDVAGILIAHLKSTAEAHLGHRIDNAVVTVP 186



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGT-ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTS 683
           +FN +QRQ      T   G   + +++E  AAA A+GL +     + +L+F LGG T+
Sbjct: 188 HFNGNQRQEVSSGSTEYGGFRYVSVVDEQVAAAAAHGLHEDRGDGKVILVFHLGGRTA 245


>06_03_1137 +
           27903012-27904196,27904330-27904542,27905775-27905867,
           27905940-27906008,27906412-27906612,27906688-27906834,
           27907524-27907652,27909001-27909131,27909240-27909333
          Length = 753

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTG 641
           ++C      YF  +QRQA  DA  ++GL  LR++++  A A+ YGL +   G
Sbjct: 142 SDCVISVPCYFTQAQRQAYLDAAAVAGLRPLRLMHDLAATALGYGLYRSDLG 193



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 236
           VG D+G         +   ++++ N + NR +P+ VAF+   RL+G  A
Sbjct: 4   VGFDVGNDTLVAAAARQRGIDVLLNAESNRESPAAVAFSHNARLLGPHA 52



 Score = 29.1 bits (62), Expect = 3.9
 Identities = 16/50 (32%), Positives = 27/50 (54%)
 Frame = +1

Query: 361 GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           GG   + V + G      P ++ +M+L  +++ AEA L   V + VI+VP
Sbjct: 100 GGGVLVHVDHIGRRIALSPTQLLAMLLGYLRQLAEADLEAPVSDCVISVP 149


>06_01_0770 -
           5756200-5756741,5756790-5757286,5757356-5757782,
           5757854-5757911
          Length = 507

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTS 683
           +Y  D ++  +  A   SG   +++++E  AAA AYG   K    + +L+F LGG TS
Sbjct: 233 SYSADGRQVLSSAAKEYSGFRAVKVVDEHIAAAAAYGHHTKQGDRKAILVFHLGGRTS 290



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/37 (40%), Positives = 27/37 (72%)
 Frame = +1

Query: 400 DKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           D  F  + ++ ++++ +K TAEA+LG+ + NAVIT+P
Sbjct: 193 DAEFSVDHLAGILISHLKHTAEAHLGRHINNAVITLP 229



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNR-TTPSYVAFT-DTERLI-GDAAKNQVAMT 257
           A  I LG T SC+  +      + A     +   PS+VA   D   +I G+AA N+ A++
Sbjct: 70  AAAIHLGNTNSCIAGYDDDDAPLGAKRSYYQFCIPSWVALAHDNGTVISGEAAMNRAALS 129

Query: 258 PTTQYS 275
           P+T  S
Sbjct: 130 PSTAVS 135


>03_02_0180 - 6211823-6213559
          Length = 578

 Score = 36.3 bits (80), Expect = 0.026
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 8/62 (12%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLIFDLG 671
           F+  Q+   + A  ++GL+VLR++ EPTA A+ Y         D  G+G E+  LIF++G
Sbjct: 180 FSRFQQTRIERACAMAGLHVLRLMPEPTAIALLYAQQQQQLLHDNMGSGIEKIALIFNMG 239

Query: 672 GG 677
            G
Sbjct: 240 AG 241



 Score = 35.5 bits (78), Expect = 0.045
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           A+GID+GT+   V V+   +VE++ N +  +   SYV F D
Sbjct: 28  AIGIDIGTSNCSVAVWTGHQVELLKNTRNQKGMRSYVMFKD 68



 Score = 34.7 bits (76), Expect = 0.079
 Identities = 19/64 (29%), Positives = 33/64 (51%)
 Frame = +1

Query: 319 ASRHEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAV 498
           AS+      + +  G +P I        ++  PEEV ++ L ++K   E +L   V+NAV
Sbjct: 114 ASKSLPFLVQTLGIGVRPFIAALVNNMWRSTTPEEVLAIFLLELKALVEMHLKHPVRNAV 173

Query: 499 ITVP 510
           +T+P
Sbjct: 174 LTIP 177



 Score = 28.3 bits (60), Expect = 6.9
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLR 376
           + IF+ KRLIGR   D  VQA  K  PF +  +   +R
Sbjct: 94  SAIFNMKRLIGRMDTDEVVQAS-KSLPFLVQTLGIGVR 130


>09_04_0565 + 18580292-18580571,18582823-18583052
          Length = 169

 Score = 31.1 bits (67), Expect = 0.98
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -1

Query: 192 KTEWSCCPGRWR*SPPSRAGRH 127
           K  WSCC  R   +PP R GRH
Sbjct: 138 KGRWSCCQERDEGAPPCRRGRH 159


>04_03_0694 +
           18781776-18781994,18782475-18782648,18782743-18783057,
           18783791-18785569,18786334-18786651,18787052-18787105
          Length = 952

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = -2

Query: 287 DVWHRILCCWGHRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARV 114
           ++  R+ CC G R  V  G  D T+G+ +R  R S          L L  L+  N  +
Sbjct: 22  EIASRVSCCSGGRGRVAVGCDDGTVGLLDRGFRLSYGFQAYASSVLFLQQLKQRNVLI 79


>04_04_1042 -
           30346132-30346285,30346629-30346759,30346867-30346938,
           30347284-30347370,30347479-30347505,30347777-30347869,
           30348470-30348558,30348649-30348727,30349102-30349231,
           30349344-30349464,30349619-30349726,30349837-30350152
          Length = 468

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -1

Query: 132 RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLS-KRARLLV 4
           +H R   W+ D F L +LL F +    CYL L+    +R R L+
Sbjct: 71  KHARFLNWHLDLFCLILLLVFVLPYYHCYLLLRNSGVRRERALL 114


>08_02_1261 +
           25689487-25689666,25690642-25690887,25691032-25691128,
           25691233-25691630,25692013-25692267
          Length = 391

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 9/35 (25%), Positives = 18/35 (51%)
 Frame = +1

Query: 100 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRS 204
           +W+P+  +L     G W  SP  ++  P  +++ S
Sbjct: 357 VWIPKHFSLSQDKNGSWECSPLEKSVPPAPIIVPS 391


>06_03_0953 - 26277946-26278800,26280177-26280676,26280735-26280849
          Length = 489

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +1

Query: 124 LVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTR 246
           L+  +  RW   P  R     +L+LR   P  SSE+P  T+
Sbjct: 171 LLGGAERRWSPPPPPRPKPKHKLVLREIEPGESSEVPSETK 211


>01_07_0278 -
           42440405-42440515,42440765-42440830,42440995-42441085,
           42441342-42441496,42441823-42442044,42442097-42442210,
           42442833-42442912,42443289-42443505
          Length = 351

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 30/104 (28%), Positives = 40/104 (38%), Gaps = 3/104 (2%)
 Frame = +3

Query: 201 FTDTERLI-GDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*D 377
           F+ TE  + G AA N     PTT  + P   +      LLC      GL   Q  R T D
Sbjct: 43  FSWTESTVHGPAATNLPGPRPTTSSAQPKQDATCDLGCLLCLAMPPKGL-RVQICRYTID 101

Query: 378 QGSI*G*RQNLFP--RGSQFHGAYENEGNCRSLSWQNCAECSYH 503
           +      R    P   G   H   E   +C S+ WQ  A  +++
Sbjct: 102 KLQTTFHRWEKTPSNTGEHVHLTKELHTSCESIEWQEEAAVAFN 145


>10_01_0121 - 1493822-1494316
          Length = 164

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +2

Query: 68  QNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPG 172
           + G+  R     G   L RWC   R+GG  R R G
Sbjct: 36  RRGRQIRPLEGHGRQRLWRWCSGGRQGGMQRGRSG 70


>11_06_0370 +
           22768977-22769523,22769619-22770642,22770784-22771170,
           22771216-22771507
          Length = 749

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +2

Query: 539 HKRCRYHLWLERSPNHQ 589
           H R  Y  WLE +PNHQ
Sbjct: 522 HFRYYYETWLEEAPNHQ 538


>03_04_0025 -
           16557328-16557851,16558000-16558123,16558518-16558654,
           16561050-16561185,16561296-16561721
          Length = 448

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)
 Frame = +2

Query: 83  TRSRNRSGYHVLLRWCLP-AREGGDHRQRPGQQDHSVLCCVHRHRAS 220
           TR + RSG+  L R CL      G  + RPG +  +     H   AS
Sbjct: 2   TRKKERSGWGSLFRGCLSGGGAAGSRKVRPGPRTAAAAAAKHGGGAS 48


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,675,998
Number of Sequences: 37544
Number of extensions: 560198
Number of successful extensions: 1910
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1723
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1873
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1992480932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -