SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0546 - 9381989-9383733,9385838-9386054                          159   3e-39
11_08_0075 + 28173220-28173433,28175348-28177083                      157   1e-38
05_05_0109 - 22454539-22456268,22457069-22457279                      157   1e-38
03_06_0484 + 34233042-34233258,34235317-34237049                      157   1e-38
01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229    157   1e-38
03_02_0540 + 9340379-9340592,9341250-9342988                          156   2e-38
02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84...   148   4e-36
03_05_0877 + 28443481-28443538,28443641-28443911,28444028-284442...   144   7e-35
08_01_0654 - 5639419-5641449                                          140   1e-33
05_04_0392 - 20889699-20891726                                        140   1e-33
05_04_0052 - 17515344-17517353                                        134   7e-32
05_03_0397 + 13488642-13488941,13489711-13489963,13490594-134906...   130   2e-30
12_02_0825 + 23476943-23476952,23477263-23477328,23477737-234778...   127   1e-29
03_02_0542 - 9348126-9349585,9352433-9352655                          123   1e-28
11_01_0564 - 4447078-4448519,4449465-4449711                          121   5e-28
03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74...   120   2e-27
02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090...   120   2e-27
11_01_0563 + 4423609-4423846,4424671-4426132,4428949-4429364,443...   107   1e-23
01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819    104   9e-23
01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165    102   4e-22
11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836          100   1e-21
12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231          100   3e-21
12_01_0346 + 2652181-2653566                                           75   6e-14
05_01_0550 + 4820086-4821255,4822112-4822321,4822429-4822524,482...    69   5e-12
01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937,425...    67   1e-11
02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728...    59   3e-09
06_03_1137 + 27903012-27904196,27904330-27904542,27905775-279058...    52   7e-07
03_02_0180 - 6211823-6213559                                           51   1e-06
05_07_0320 + 29235266-29235305,29235409-29236682                       49   5e-06
06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575...    44   1e-04
06_03_0067 - 16167420-16167845,16168291-16168406,16168634-161688...    41   0.001
07_01_0786 + 6122144-6123187                                           33   0.25 
09_04_0565 + 18580292-18580571,18582823-18583052                       31   1.00 
04_03_0694 + 18781776-18781994,18782475-18782648,18782743-187830...    31   1.00 
04_04_1042 - 30346132-30346285,30346629-30346759,30346867-303469...    30   1.7  
06_03_0953 - 26277946-26278800,26280177-26280676,26280735-26280849     30   2.3  
10_08_0775 + 20484776-20486035                                         29   3.0  
08_02_1261 + 25689487-25689666,25690642-25690887,25691032-256911...    29   4.0  
05_03_0458 + 14280953-14281866,14281964-14282912                       29   4.0  
08_01_0876 - 8598664-8599374                                           29   5.3  
10_01_0121 - 1493822-1494316                                           28   7.0  
11_06_0686 + 26280772-26281611                                         28   9.3  
11_06_0370 + 22768977-22769523,22769619-22770642,22770784-227711...    28   9.3  
07_03_1728 + 29076733-29079069                                         28   9.3  
06_03_0501 + 21476715-21476785,21477045-21477786,21478097-214782...    28   9.3  
03_04_0025 - 16557328-16557851,16558000-16558123,16558518-165586...    28   9.3  
02_01_0302 - 2021221-2023305                                           28   9.3  

>03_02_0546 - 9381989-9383733,9385838-9386054
          Length = 653

 Score =  159 bits (385), Expect = 3e-39
 Identities = 77/86 (89%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--GTGERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK   TGE+NVLIFDLGGG
Sbjct: 151 VPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAASTGEKNVLIFDLGGG 210

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVSILTIE+GIFEVK+TAGDTH G
Sbjct: 211 TFDVSILTIEEGIFEVKATAGDTHLG 236



 Score =  124 bits (298), Expect = 1e-28
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F D +VQADMK WPF+VV     KP I V YKGE+K F  EE+
Sbjct: 65  MNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFSAEEI 124

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVLTKMKE AEA+L  T++NAVIT P
Sbjct: 125 SSMVLTKMKEIAEAFLSTTIKNAVITVP 152



 Score =  118 bits (283), Expect = 7e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 66

Query: 261 PT 266
           PT
Sbjct: 67  PT 68


>11_08_0075 + 28173220-28173433,28175348-28177083
          Length = 649

 Score =  157 bits (380), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  123 bits (297), Expect = 1e-28
 Identities = 57/88 (64%), Positives = 72/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F DA+VQ+D+K WPF+V++  G KP I V YKGE+K F  EE+
Sbjct: 64  MNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEAYLG T++NAV+T P
Sbjct: 124 SSMVLIKMREIAEAYLGTTIKNAVVTVP 151



 Score =  112 bits (270), Expect = 3e-25
 Identities = 51/61 (83%), Positives = 56/61 (91%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA  
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMN 65

Query: 261 P 263
           P
Sbjct: 66  P 66


>05_05_0109 - 22454539-22456268,22457069-22457279
          Length = 646

 Score =  157 bits (380), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 149 VPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSSGEKNVLIFDLGGG 208

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 209 TFDVSLLTIEEGIFEVKATAGDTHLG 234



 Score =  123 bits (296), Expect = 2e-28
 Identities = 57/88 (64%), Positives = 70/88 (79%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F D +VQ+DMK WPF+VV   G KP I V YKGE+K F  EE+
Sbjct: 63  MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI 122

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEAYLG +++NAV+T P
Sbjct: 123 SSMVLIKMREIAEAYLGSSIKNAVVTVP 150



 Score =  118 bits (283), Expect = 7e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  
Sbjct: 5   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 64

Query: 261 PT 266
           PT
Sbjct: 65  PT 66


>03_06_0484 + 34233042-34233258,34235317-34237049
          Length = 649

 Score =  157 bits (380), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 151 VPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGG 210

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 211 TFDVSLLTIEEGIFEVKATAGDTHLG 236



 Score =  123 bits (296), Expect = 2e-28
 Identities = 57/88 (64%), Positives = 71/88 (80%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F DA+VQ+D+K WP++V+   G KP I V YKGE+K F  EE+
Sbjct: 65  MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI 124

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEAYLG TV+NAV+T P
Sbjct: 125 SSMVLIKMREIAEAYLGSTVKNAVVTVP 152



 Score =  114 bits (274), Expect = 8e-26
 Identities = 52/61 (85%), Positives = 56/61 (91%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA  
Sbjct: 7   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN 66

Query: 261 P 263
           P
Sbjct: 67  P 67


>01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229
          Length = 841

 Score =  157 bits (380), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 342 VPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSSGEKNVLIFDLGGG 401

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 402 TFDVSLLTIEEGIFEVKATAGDTHLG 427



 Score =  121 bits (291), Expect = 7e-28
 Identities = 56/88 (63%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F D +VQ+DMK WPF+V+   G KP I V YKGE+K F  EE+
Sbjct: 256 MNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEI 315

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEAYLG  ++NAV+T P
Sbjct: 316 SSMVLIKMREIAEAYLGSNIKNAVVTVP 343



 Score =  114 bits (275), Expect = 6e-26
 Identities = 55/66 (83%), Positives = 60/66 (90%), Gaps = 2/66 (3%)
 Frame = +3

Query: 72  KMAKA--PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           +MAK   PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct: 193 EMAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 252

Query: 246 QVA*TP 263
           QVA  P
Sbjct: 253 QVAMNP 258


>03_02_0540 + 9340379-9340592,9341250-9342988
          Length = 650

 Score =  156 bits (379), Expect = 2e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKSSSVGEKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  124 bits (300), Expect = 6e-29
 Identities = 59/88 (67%), Positives = 70/88 (79%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F D +VQ+D K WPF+V+   G KP I V YKGE+K F  EE+
Sbjct: 64  MNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KMKETAEAYLG TV+NAV+T P
Sbjct: 124 SSMVLNKMKETAEAYLGSTVKNAVVTVP 151



 Score =  113 bits (273), Expect = 1e-25
 Identities = 52/59 (88%), Positives = 56/59 (94%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  P
Sbjct: 8   PAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP 66


>02_01_0112 -
           839048-839552,839638-839720,839828-839982,840078-840557,
           840855-841097,841189-841403,841489-841756,842477-842525
          Length = 665

 Score =  148 bits (359), Expect = 4e-36
 Identities = 69/84 (82%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGTF
Sbjct: 176 VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTF 234

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI++G+FEV +T GDTH G
Sbjct: 235 DVSILTIDNGVFEVLATNGDTHLG 258



 Score =  117 bits (281), Expect = 1e-26
 Identities = 57/88 (64%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEV 430
           VNP  TIFD KRLIGRKFED  VQ DMK  P+++V+  GKP I+V  K GE+K F PEEV
Sbjct: 90  VNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEV 149

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+M+L KMKETAEAYLGK + +AV+T P
Sbjct: 150 SAMILGKMKETAEAYLGKKINDAVVTVP 177



 Score =   99 bits (238), Expect = 2e-21
 Identities = 45/57 (78%), Positives = 52/57 (91%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFTD+ERLIG+AAKNQ A  P
Sbjct: 36  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNP 92


>03_05_0877 +
           28443481-28443538,28443641-28443911,28444028-28444242,
           28444329-28445057,28445143-28445297,28445384-28445965
          Length = 669

 Score =  144 bits (349), Expect = 7e-35
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +1

Query: 481 QNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNV 657
           Q   +    VPAYFND+QRQATKDAGTI+GLNV RIINEPTAAAIAYGLD+KG GE  NV
Sbjct: 171 QRVTDAVVTVPAYFNDAQRQATKDAGTIAGLNVPRIINEPTAAAIAYGLDRKGAGEMTNV 230

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           L++DLGGGTFDVS+L+++ G+FEV +T+GDTH G
Sbjct: 231 LVYDLGGGTFDVSVLSLDHGVFEVLATSGDTHLG 264



 Score =  112 bits (270), Expect = 3e-25
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEV 430
           +NP+ TIFD KRLIGR+F+D  VQ D+K+ P++VV  GGKP ++V  K GE K F PEE+
Sbjct: 94  LNPDRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEI 153

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+M+L KMKETAE+YLG+ V +AV+T P
Sbjct: 154 SAMILAKMKETAESYLGQRVTDAVVTVP 181



 Score =  102 bits (244), Expect = 4e-22
 Identities = 44/64 (68%), Positives = 54/64 (84%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 251
           +  K P +GIDLGTTYSCVGV+++G V+I+ANDQGNR TPS+VAFTD ERL+G+AAKNQ 
Sbjct: 33  RKTKGPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQA 92

Query: 252 A*TP 263
           A  P
Sbjct: 93  ALNP 96


>08_01_0654 - 5639419-5641449
          Length = 676

 Score =  140 bits (338), Expect = 1e-33
 Identities = 66/84 (78%), Positives = 75/84 (89%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V RIINEPTAAAIAYG+DKKG  E+NVL+FDLGGGTF
Sbjct: 188 VPAYFNDAQRQATKDAGVIAGLTVDRIINEPTAAAIAYGIDKKG-AEKNVLVFDLGGGTF 246

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I++G+FEV +T GDTH G
Sbjct: 247 DVSILAIDNGVFEVLATNGDTHLG 270



 Score =  111 bits (267), Expect = 6e-25
 Identities = 55/87 (63%), Positives = 65/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 433
           NP  TI+DAKRLIGR+F DA VQ DMK  PF VV   GKP ++V  K G+ + F PEEVS
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVS 162

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLT+MKETAEAYLG+ V  AV+T P
Sbjct: 163 AMVLTRMKETAEAYLGEKVTRAVVTVP 189



 Score = 94.3 bits (224), Expect = 9e-20
 Identities = 45/58 (77%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104


>05_04_0392 - 20889699-20891726
          Length = 675

 Score =  140 bits (338), Expect = 1e-33
 Identities = 66/84 (78%), Positives = 75/84 (89%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL V RIINEPTAAAIAYG+DKKG  E+NVL+FDLGGGTF
Sbjct: 188 VPAYFNDAQRQATKDAGVIAGLTVDRIINEPTAAAIAYGIDKKG-AEKNVLVFDLGGGTF 246

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I++G+FEV +T GDTH G
Sbjct: 247 DVSILAIDNGVFEVLATNGDTHLG 270



 Score =  111 bits (267), Expect = 6e-25
 Identities = 55/87 (63%), Positives = 65/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 433
           NP  TI+DAKRLIGR+F DA VQ DMK  PF VV   GKP ++V  K G+ + F PEEVS
Sbjct: 103 NPERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVS 162

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVLT+MKETAEAYLG+ V  AV+T P
Sbjct: 163 AMVLTRMKETAEAYLGEKVTRAVVTVP 189



 Score = 92.7 bits (220), Expect = 3e-19
 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD-TERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPS+VAFTD  ERLIG+AAKNQ A  P
Sbjct: 47  IGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP 104


>05_04_0052 - 17515344-17517353
          Length = 669

 Score =  134 bits (324), Expect = 7e-32
 Identities = 60/84 (71%), Positives = 73/84 (86%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDA TI+GL V RI+NEPTAAA+AYG+ K+G G +NVL+FDLGGGTF
Sbjct: 183 VPAYFNDAQRQATKDAATIAGLAVERILNEPTAAALAYGVGKEGAGGKNVLVFDLGGGTF 242

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I+ G++EV +T GDTH G
Sbjct: 243 DVSVLAIDGGVYEVLATNGDTHLG 266



 Score =  108 bits (260), Expect = 4e-24
 Identities = 52/87 (59%), Positives = 64/87 (73%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGED-KTFFPEEVS 433
           NP  T++DAKRLIGR+F DA VQ DM+  PF VV  GGKP ++V  +G D +   PEEVS
Sbjct: 98  NPGRTVYDAKRLIGRRFADAEVQRDMRLLPFAVVDKGGKPHVRVEVRGGDVRLLSPEEVS 157

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +MVL +MKETAEAYLG+ V  AV+T P
Sbjct: 158 AMVLARMKETAEAYLGEEVTRAVVTVP 184



 Score = 91.5 bits (217), Expect = 7e-19
 Identities = 44/58 (75%), Positives = 50/58 (86%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VAFT   ERLIG+AAKNQ A  P
Sbjct: 42  IGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTGGGERLIGEAAKNQAAANP 99


>05_03_0397 +
           13488642-13488941,13489711-13489963,13490594-13490673,
           13491251-13491393,13491512-13491610,13491785-13491974,
           13492504-13492902,13492993-13493400
          Length = 623

 Score =  130 bits (313), Expect = 2e-30
 Identities = 60/84 (71%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDLGGGTF
Sbjct: 124 VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDLGGGTF 181

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DG+FEV ST+GDTH G
Sbjct: 182 DVSVLEVGDGVFEVLSTSGDTHLG 205



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 33/87 (37%), Positives = 44/87 (50%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           VNP NT F  KR IGRK  +  V  + K   + V+ D     +K+      K F  EE+S
Sbjct: 42  VNPENTFFSVKRFIGRKMNE--VDEESKQVSYRVIRDDNG-NVKLDCPAIGKQFAAEEIS 98

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL K+ + A  +L   V  AVIT P
Sbjct: 99  AQVLRKLVDDASKFLNDKVTKAVITVP 125



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query: 144 GKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TPTTQY 275
           GK  I+ N +G RTTPS VA+T + +RL+G  AK Q    P   +
Sbjct: 4   GKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTF 48


>12_02_0825 +
           23476943-23476952,23477263-23477328,23477737-23477885,
           23478148-23478212,23479247-23479710,23479724-23480208
          Length = 412

 Score =  127 bits (306), Expect = 1e-29
 Identities = 66/86 (76%), Positives = 72/86 (83%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFN SQRQATKDA  I+GLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGG
Sbjct: 180 VPAYFNYSQRQATKDARVIAGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGG 239

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+G       AGDTH G
Sbjct: 240 TFDVSLLTIEEG-------AGDTHLG 258



 Score =  101 bits (241), Expect = 8e-22
 Identities = 48/80 (60%), Positives = 62/80 (77%), Gaps = 1/80 (1%)
 Frame = +2

Query: 278 DAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 454
           DAKRLIG++F DA+VQ+D+  WPF+V++  G K  I V YKGE+K F  EE+SSMVL KM
Sbjct: 102 DAKRLIGQRFTDASVQSDIMLWPFKVIAGPGDKSMIVVQYKGEEKQFAAEEISSMVLIKM 161

Query: 455 KETAEAYLGKTVQNAVITFP 514
           +E AEAYLG T++ AV+T P
Sbjct: 162 REIAEAYLGTTIKKAVVTVP 181



 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 442
           N   +AKRLIGR+F DA+VQ+D+K WPF+V++  G K  I V YKGE+K    E++    
Sbjct: 22  NMAENAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKSTIVVQYKGEEKQVAAEQIDDET 81

Query: 443 LTKMKETAEAYLG 481
           ++     A+ Y G
Sbjct: 82  ISPSVCYADPYDG 94


>03_02_0542 - 9348126-9349585,9352433-9352655
          Length = 560

 Score =  123 bits (297), Expect = 1e-28
 Identities = 63/93 (67%), Positives = 72/93 (77%), Gaps = 9/93 (9%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK---KGTGERNVLIFDLGG 678
           VP YFNDSQRQAT DAG ++GL+VLRIINEPTAAA+AYGLDK       ++ VLIFDLGG
Sbjct: 153 VPVYFNDSQRQATMDAGAVAGLDVLRIINEPTAAAVAYGLDKVVGSSDKKKRVLIFDLGG 212

Query: 679 GTFDVSILTIED------GIFEVKSTAGDTHFG 759
           GT DVS+L I+       GIFEVK+TAGDTH G
Sbjct: 213 GTLDVSVLNIDPGVDIDIGIFEVKATAGDTHLG 245



 Score =  117 bits (281), Expect = 1e-26
 Identities = 57/88 (64%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEV 430
           +NP NTIFDAKRLIGR+F D +VQ D+K WPF+V S    +P I V Y+GE+K F  EE+
Sbjct: 67  MNPLNTIFDAKRLIGRRFSDVSVQGDIKLWPFKVTSGKDDRPMIVVQYRGEEKEFSAEEI 126

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+MVL KMKETAEAYL KTV+ AVIT P
Sbjct: 127 SAMVLFKMKETAEAYLDKTVEKAVITVP 154



 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 45/59 (76%), Positives = 49/59 (83%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           PAVGIDLGTTYSCV V++ G+VE+I NDQGN TTPS VAFTDT RLIGDAA NQ A  P
Sbjct: 11  PAVGIDLGTTYSCVAVWRRGRVEVIPNDQGNLTTPSCVAFTDTWRLIGDAALNQAAMNP 69


>11_01_0564 - 4447078-4448519,4449465-4449711
          Length = 562

 Score =  121 bits (292), Expect = 5e-28
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 8/92 (8%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE--RNVLIFDLGGG 681
           VP YFN++QRQAT DAG I+GLNV+RIINEPTAAA+AYGL+K       R VL+FDLGGG
Sbjct: 161 VPVYFNNAQRQATMDAGAIAGLNVMRIINEPTAAALAYGLEKMPVSNKGRMVLVFDLGGG 220

Query: 682 TFDVSILTIEDGI------FEVKSTAGDTHFG 759
           TFD+S+L I+ G+      FEVK+TAGDTH G
Sbjct: 221 TFDISLLNIDPGVNIDMGLFEVKATAGDTHLG 252



 Score =  118 bits (283), Expect = 7e-27
 Identities = 55/88 (62%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NTIF+ KRLIGR+F D +VQ D+K WPF+VV+    +P I V ++GE++ F PEE+
Sbjct: 75  LNPTNTIFEVKRLIGRRFSDDSVQKDIKLWPFKVVAGQEDRPMIVVRHEGEERQFMPEEI 134

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+ETAE YLGKTV NAVIT P
Sbjct: 135 SSMVLAKMRETAEVYLGKTVTNAVITVP 162



 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 42/62 (67%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT--DTERLIGDAAKNQVA*T 260
           PAVGIDLGTTYSCV V++H + E+IANDQGNR TPS VAFT  D +  +GDAA NQ A  
Sbjct: 17  PAVGIDLGTTYSCVAVWRHDRGEVIANDQGNRLTPSCVAFTADDDDSFVGDAAFNQSALN 76

Query: 261 PT 266
           PT
Sbjct: 77  PT 78


>03_01_0093 -
           745434-746057,746492-747112,747222-747791,747870-747948,
           748258-748331,748385-748387
          Length = 656

 Score =  120 bits (288), Expect = 2e-27
 Identities = 58/84 (69%), Positives = 69/84 (82%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG + K   E  + +FDLGGGTF
Sbjct: 173 VPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTNNK---EGLIAVFDLGGGTF 229

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I +G+FEVK+T GDT  G
Sbjct: 230 DVSILEISNGVFEVKATNGDTFLG 253



 Score = 82.2 bits (194), Expect = 4e-16
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT F  KRLIGR+F+D   Q +MK  P+++V    G   ++     + K + P ++ 
Sbjct: 91  NPQNTFFGTKRLIGRRFDDPQTQKEMKMVPYKIVKALNGDAWLETT---DGKQYSPSQIG 147

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VLTKMKETAE+YLGK+V  AVIT P
Sbjct: 148 AFVLTKMKETAESYLGKSVSKAVITVP 174



 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TPTT 269
           +GIDLGTT SCV V +    ++I N +G RTTPS VAF    E L+G  AK Q    P  
Sbjct: 35  IGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGELLVGTPAKRQAVTNPQN 94

Query: 270 QY 275
            +
Sbjct: 95  TF 96


>02_05_0916 -
           32706039-32706332,32707483-32708103,32708450-32709070,
           32709183-32709752,32709840-32709918,32710002-32710075,
           32711336-32711398
          Length = 773

 Score =  120 bits (288), Expect = 2e-27
 Identities = 58/84 (69%), Positives = 69/84 (82%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG + K   E  + +FDLGGGTF
Sbjct: 193 VPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGTNNK---EGLIAVFDLGGGTF 249

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I +G+FEVK+T GDT  G
Sbjct: 250 DVSILEISNGVFEVKATNGDTFLG 273



 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 43/87 (49%), Positives = 57/87 (65%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT F  KRLIGR+FED   Q +MK  P+++V +  G   ++     + K + P ++ 
Sbjct: 111 NPQNTFFGTKRLIGRRFEDPQTQKEMKMVPYKIVKAPNGDAWVETT---DGKQYSPSQIG 167

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VLTKMKETAE+YLGKTV  AVIT P
Sbjct: 168 AFVLTKMKETAESYLGKTVSKAVITVP 194



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TPTT 269
           +GIDLGTT SCV V +    ++I N +G RTTPS VAF    ERL+G  AK Q    P  
Sbjct: 55  IGIDLGTTNSCVSVMEGKNPKVIENSEGTRTTPSVVAFNQKGERLVGTPAKRQAVTNPQN 114

Query: 270 QY 275
            +
Sbjct: 115 TF 116


>11_01_0563 +
           4423609-4423846,4424671-4426132,4428949-4429364,
           4430555-4432052,4432199-4432217,4432469-4432675,
           4432814-4433065
          Length = 1363

 Score =  107 bits (256), Expect = 1e-23
 Identities = 60/99 (60%), Positives = 70/99 (70%), Gaps = 15/99 (15%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNVLIFDLG 675
           VP YFN++QR+AT DA TI+GLNV+RIINEP+AAA+AYGLDK     G   R VLIFDLG
Sbjct: 158 VPVYFNNAQREATLDAATIAGLNVMRIINEPSAAALAYGLDKMPPASGGAGRMVLIFDLG 217

Query: 676 GGTFDVSILTI---------EDGI--FEVKSTAGDTHFG 759
           GGT DVS+L I         + G   FEVK+ AGDTH G
Sbjct: 218 GGTLDVSLLNIGRPGNNNSSDSGSFEFEVKAVAGDTHLG 256



 Score =  105 bits (251), Expect = 5e-23
 Identities = 47/93 (50%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTF 415
           +    +NP NTIF+ KRLIGR+F D +VQ D+K WPF+V++    +P I V ++G++K F
Sbjct: 67  ENQAALNPTNTIFEVKRLIGRRFSDKSVQEDIKLWPFKVIAGRDDRPTIVVRHEGKEKQF 126

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
            PEE+S+MVL+K+++ A AYLG+ V +AVIT P
Sbjct: 127 VPEEISAMVLSKLRDAAVAYLGEPVTDAVITVP 159



 Score =  102 bits (245), Expect = 3e-22
 Identities = 60/105 (57%), Positives = 70/105 (66%), Gaps = 21/105 (20%)
 Frame = +1

Query: 508  VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK--------GTGERNVLI 663
            VP YFN++QR+AT DA  I+GLNV+RIINEP+AAAIAYGLDK         G   R VLI
Sbjct: 784  VPVYFNNAQREATLDAAAIAGLNVMRIINEPSAAAIAYGLDKMPPPPASGGGAAVRTVLI 843

Query: 664  FDLGGGTFDVSILTI----------EDGI---FEVKSTAGDTHFG 759
            FDLGGGT DVS+L I          ++G    FEVK+ AGDTH G
Sbjct: 844  FDLGGGTLDVSLLNIGRPGNNSNSGDNGSSFEFEVKAVAGDTHLG 888



 Score =  102 bits (244), Expect = 4e-22
 Identities = 47/93 (50%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = +2

Query: 239 QEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTF 415
           +    +NP NTIF+AKRLIGR+F   +VQ D+K WPF+VV+    +P I V ++G++  F
Sbjct: 693 ENQAALNPTNTIFEAKRLIGRRFSSKSVQEDIKLWPFKVVAGPDDRPTIVVQHEGKEMQF 752

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
            PEE+S+MVL+K+++ A AYLG+ V +AVIT P
Sbjct: 753 VPEEISAMVLSKLRDAAVAYLGEPVTDAVITVP 785



 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 39/60 (65%), Positives = 46/60 (76%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           PA+GIDLGTTYSC  V +H + E+I NDQGNR TPS VAFT  +R +GDAA+NQ A  PT
Sbjct: 642 PAIGIDLGTTYSCAAVRRHNRSEVITNDQGNRITPSCVAFTADDRFVGDAAENQAALNPT 701



 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 39/60 (65%), Positives = 45/60 (75%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           PA+GIDLGTTYSCV V +  + E I NDQGNR TPS VAFT  +R +GDAA+NQ A  PT
Sbjct: 16  PAIGIDLGTTYSCVAVRRRYRSEAITNDQGNRITPSCVAFTAADRFVGDAAENQAALNPT 75



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 7/42 (16%)
 Frame = +1

Query: 655  VLIFDLGGGTFDVSILTIEDGI-------FEVKSTAGDTHFG 759
            VL+FDLGGGTFDVS+L I+ G+       FEVK+TAGDTH G
Sbjct: 1231 VLVFDLGGGTFDVSLLNIDPGVNTDMGRLFEVKATAGDTHLG 1272


>01_06_0316 - 28419072-28419373,28419405-28420502,28420600-28420819
          Length = 539

 Score =  104 bits (249), Expect = 9e-23
 Identities = 50/99 (50%), Positives = 68/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 433
           NP NT+F  KRL+GR+F DA+VQ  +K WPF+VV   G KP +  +YKG+ K    EEV+
Sbjct: 67  NPTNTVFATKRLMGRRFSDASVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKLLAAEEVA 126

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           SM+L+KMK  AEAY+G  V+NAV+T P +   L+ +  K
Sbjct: 127 SMLLSKMKAEAEAYIGGPVKNAVVTVPASFDVLQRRATK 165



 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 38/60 (63%), Positives = 47/60 (78%)
 Frame = +3

Query: 87  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPT 266
           P +GIDLGT  SCV V+Q+G+ EI+ N+ G R TPSY AFTDTERL+GDAAK+Q +  PT
Sbjct: 10  PVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDTERLVGDAAKSQASRNPT 69



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 42/84 (50%), Positives = 60/84 (71%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR+ATK A  ++GL+VL +I+ P AAA+A+G+ +   G++NVL+FDLGGG  
Sbjct: 152 VPASFDVLQRRATKHACAVAGLDVLGVIHGPAAAAVAFGIHEIA-GDKNVLVFDLGGGHT 210

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
            VS+L +  G   V++TAGD H G
Sbjct: 211 SVSLLAVASGKIAVRATAGDPHLG 234


>01_05_0122 + 18366119-18367014,18367042-18367397,18367471-18368165
          Length = 648

 Score =  102 bits (244), Expect = 4e-22
 Identities = 45/84 (53%), Positives = 62/84 (73%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VP YFND+QR+A  DAG I+GL+V+RI++EP AAA+AYGLD   +  + V++FDLGG   
Sbjct: 179 VPVYFNDAQRRAISDAGDIAGLDVMRIVSEPIAAAVAYGLDNVRSNGKRVVVFDLGGENL 238

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DV+ L  +DG F+V +T GD + G
Sbjct: 239 DVTALVADDGFFDVLATNGDGYLG 262



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 38/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV-AYKGEDKTFFPEEVS 433
           +P   + D  RL+G+K  D  VQ +M   P+ VV   GKP + V A  G+ +   PEE++
Sbjct: 94  SPGRAVHDFMRLLGKKLGDDDVQREMTRLPYAVVDMEGKPHVLVEAADGDVRVLSPEEIA 153

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL KMK+TAEA+LG+TV +AV+  P
Sbjct: 154 AAVLAKMKKTAEAHLGRTVSSAVVAVP 180



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD--TERLIGDAAKNQVA*TP 263
           +GID+G TYSCV V+  G+VEII NDQG+R TPS+VAFTD     ++G+AAK Q   +P
Sbjct: 37  LGIDIGATYSCVAVYCKGRVEIIPNDQGSRLTPSWVAFTDGGGRLVVGEAAKEQAVGSP 95


>11_01_0565 - 4457019-4457052,4457175-4458675,4460791-4460836
          Length = 526

 Score =  100 bits (240), Expect = 1e-21
 Identities = 59/104 (56%), Positives = 69/104 (66%), Gaps = 20/104 (19%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK-------KGTGERNVLIF 666
           VP YFN++QR+AT DA  I+GLNV+RIINEP+AAAIAYGLDK            R VLIF
Sbjct: 94  VPVYFNNAQREATLDAAAIAGLNVMRIINEPSAAAIAYGLDKMPPPASGADAAGRTVLIF 153

Query: 667 DLGGGTFDVSILTI-----------EDGI--FEVKSTAGDTHFG 759
           DLGGGT DVS+L I           ++G   FEVK+ AGDTH G
Sbjct: 154 DLGGGTLDVSLLNIARPGNNSSSNSDNGSFEFEVKAVAGDTHLG 197



 Score = 87.8 bits (208), Expect = 8e-18
 Identities = 41/80 (51%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query: 278 DAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKM 454
           +AKRLIGR+F D +VQ D+K WPF+V++    +P I V ++G++  F PEEVS+MVL+K+
Sbjct: 16  EAKRLIGRRFSDKSVQEDIKLWPFKVIAGPDDRPTIVVQHEGKEMQFVPEEVSAMVLSKL 75

Query: 455 KETAEAYLGKTVQNAVITFP 514
           ++ A AYL + V +AVIT P
Sbjct: 76  RDAAVAYLSEPVTDAVITVP 95


>12_01_0850 + 7985289-7985789,7986636-7986888,7987173-7987231
          Length = 270

 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 47/63 (74%), Positives = 53/63 (84%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG +KK      +L+FDLGGGTF
Sbjct: 191 VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKK--NNETILVFDLGGGTF 248

Query: 688 DVS 696
           DVS
Sbjct: 249 DVS 251



 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 32/69 (46%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ 248
           ++A    VGIDLGTT S V   + GK  +I N +G RTTPS VA+T   ERL+G  AK Q
Sbjct: 47  RVACEKVVGIDLGTTNSAVAAMEGGKPTVITNAEGQRTTPSVVAYTKGGERLVGQIAKRQ 106

Query: 249 VA*TPTTQY 275
               P   +
Sbjct: 107 AVVNPENTF 115



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 33/87 (37%), Positives = 44/87 (50%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           VNP NT F  KR IGRK   A V  + K   + VV D     +K+      K F  EE+S
Sbjct: 109 VNPENTFFSVKRFIGRKM--AEVDDEAKQVSYHVVRDDNG-NVKLDCPAIGKQFAAEEIS 165

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL K+ + A  +L   +  AV+T P
Sbjct: 166 AQVLRKLVDDASKFLNDKITKAVVTVP 192


>12_01_0346 + 2652181-2653566
          Length = 461

 Score = 74.9 bits (176), Expect = 6e-14
 Identities = 35/85 (41%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           VP YF+D  R+A  +A  ++GL  +RII+EPTAAA+++GL      +  NVL+  +GGGT
Sbjct: 184 VPYYFSDGPREAAMNAARMAGLTTVRIIDEPTAAAVSHGLHHGRLRDGGNVLVLHVGGGT 243

Query: 685 FDVSILTIEDGIFEVKSTAGDTHFG 759
              ++LT ++ +FE  ++  D H G
Sbjct: 244 SAATVLTYDNAVFEAVASRHDAHLG 268



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = +2

Query: 284 KRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKV--AYKGEDKTFFPEEVSSMVLTKMK 457
           KRL+G +F    V+   +H P+++V       I+V     G  ++ +  +V+SMV+ ++K
Sbjct: 104 KRLLGTRFGSPEVRRAAEHLPYKIVDWCTMAHIEVNAGAGGAARSVYASDVASMVIAELK 163

Query: 458 ETAEAYL---GKTVQNAVITFP 514
             AEA L   GK V NAV+T P
Sbjct: 164 ARAEARLAGGGKKVHNAVVTVP 185



 Score = 33.1 bits (72), Expect = 0.25
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVA 254
           + +DLG T SCV  +     E  A        P+ VAFT D + L+G+AAKN  A
Sbjct: 47  IAVDLGNTNSCVAGYGD---EADAPPLFRLCIPTSVAFTGDGDALVGEAAKNHPA 98


>05_01_0550 +
           4820086-4821255,4822112-4822321,4822429-4822524,
           4822610-4822828,4823201-4823395,4823466-4823612,
           4823712-4823861,4825015-4825145,4825234-4825477
          Length = 853

 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 663
           +C   +PAYF D QR+A  DA  I+GL  LR+ +E TA A+AYG+ K    E+   NV  
Sbjct: 139 DCCIGIPAYFTDLQRRAVADAAAIAGLRPLRLFHETTATALAYGIYKTDLPEKEWLNVAF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  VSI+  + G   + S A D   G
Sbjct: 199 IDVGHASMQVSIVGYKKGQLNMLSHAYDRSLG 230



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG--GKPKIKVAYKGEDKTFFPEE 427
           +NP N++   KRL+GR F D  +Q D+  +PF  VS+G  G P +   Y GED+ F P +
Sbjct: 58  MNPRNSVSQIKRLLGRAFADPELQRDLASFPFR-VSEGPDGFPLVHARYLGEDRAFTPTQ 116

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + +MVL+ +K  AE  L   V +  I  P
Sbjct: 117 LLAMVLSNLKGIAEGNLNAAVFDCCIGIP 145



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDA 236
           VG D+G     V V +   ++++ N++  R TP+ V F D +R IG A
Sbjct: 4   VGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTA 51


>01_01_0573 +
           4253484-4254653,4255526-4255735,4255842-4255937,
           4256034-4256255,4256829-4257023,4257097-4257243,
           4257323-4257472,4257762-4257892,4257978-4258194
          Length = 845

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG--GKPKIKVAYKGEDKTFFPEE 427
           +NP N++   KRL+GRK+ D  +Q D+  +PF  VS+G  G P +   Y GE++ F P +
Sbjct: 58  MNPKNSVSQIKRLLGRKYSDPELQRDIAAFPFR-VSEGPDGFPLVHARYLGEERVFTPTQ 116

Query: 428 VSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + +MVL+ +K  AE+ L   V +  I  P
Sbjct: 117 LMAMVLSNLKGIAESNLNTAVVDCCIGIP 145



 Score = 64.5 bits (150), Expect = 9e-11
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 663
           +C   +P YF D QR+A  DA TI+GL  LR+ +E TA A+AYG+ K    E    NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLCPLRLFHETTATALAYGIYKTDLPENDQLNVAF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  V I   + G  ++ S A D   G
Sbjct: 199 VDVGHASMQVCIAGYKKGQLKILSHAYDRSLG 230



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDA 236
           VG DLG     V V +   ++++ N++  R TP+ V F D +R IG A
Sbjct: 4   VGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTA 51


>02_05_0491 +
           29470575-29471351,29471574-29471806,29472697-29472856,
           29473149-29473394,29473492-29473628,29473874-29474207,
           29474283-29474444,29474717-29474791,29474866-29474966,
           29475042-29475111,29475210-29475266,29475357-29475418,
           29475505-29475577,29475663-29475884
          Length = 902

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 1/60 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGE-RNVLIFDLGGGT 684
           VP YF  ++R+A   A  ++G+NVL +INE   AA+ YG+DK  + E R+V+ +D+G G+
Sbjct: 174 VPPYFGQAERRALTQAAQLAGVNVLALINEHAGAALQYGIDKDFSNESRHVIFYDMGAGS 233



 Score = 35.1 bits (77), Expect = 0.061
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 4/101 (3%)
 Frame = +2

Query: 224 HRRCRQEPGGV---NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY 394
           +R   +E  G+   +P+     A+ L+ + F      A+    P+++V D    +   A 
Sbjct: 78  NRLAGEEASGITARHPSKVFARARDLLAKPFPYVRSVAEALFLPYDLVPDA---RGAAAV 134

Query: 395 KGED-KTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           + +D + +  EE+ +MVL      A+A++G  V++AV+  P
Sbjct: 135 RADDGQVYTVEEIVAMVLHYAAGLADAHVGAPVRDAVVAVP 175


>06_03_1137 +
           27903012-27904196,27904330-27904542,27905775-27905867,
           27905940-27906008,27906412-27906612,27906688-27906834,
           27907524-27907652,27909001-27909131,27909240-27909333
          Length = 753

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVL 660
           ++C   VP YF  +QRQA  DA  ++GL  LR++++  A A+ YGL   D  G G    +
Sbjct: 142 SDCVISVPCYFTQAQRQAYLDAAAVAGLRPLRLMHDLAATALGYGLYRSDLGGPGGPTYV 201

Query: 661 IF-DLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            F D+G     V+++  +    +V S   D   G
Sbjct: 202 AFVDVGHCDTQVAVVAFDVSGMKVLSHRFDADLG 235



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           VG D+G         +   ++++ N + NR +P+ VAF+   RL+G  A
Sbjct: 4   VGFDVGNDTLVAAAARQRGIDVLLNAESNRESPAAVAFSHNARLLGPHA 52


>03_02_0180 - 6211823-6213559
          Length = 578

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLI 663
           +P  F+  Q+   + A  ++GL+VLR++ EPTA A+ Y         D  G+G E+  LI
Sbjct: 176 IPVAFSRFQQTRIERACAMAGLHVLRLMPEPTAIALLYAQQQQQLLHDNMGSGIEKIALI 235

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDT 750
           F++G G  D ++     G+ ++++ +G T
Sbjct: 236 FNMGAGYCDAAVAATAGGVSQIRALSGST 264



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = +2

Query: 266 NTIFDAKRLIGRKFEDATVQADMKHWPF--EVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 439
           + IF+ KRLIGR   D  VQA  K  PF  + +  G +P I        ++  PEEV ++
Sbjct: 94  SAIFNMKRLIGRMDTDEVVQAS-KSLPFLVQTLGIGVRPFIAALVNNMWRSTTPEEVLAI 152

Query: 440 VLTKMKETAEAYLGKTVQNAVITFP 514
            L ++K   E +L   V+NAV+T P
Sbjct: 153 FLLELKALVEMHLKHPVRNAVLTIP 177



 Score = 35.5 bits (78), Expect = 0.046
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 212
           A+GID+GT+   V V+   +VE++ N +  +   SYV F D
Sbjct: 28  AIGIDIGTSNCSVAVWTGHQVELLKNTRNQKGMRSYVMFKD 68


>05_07_0320 + 29235266-29235305,29235409-29236682
          Length = 437

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGT-ISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 684
           VP +FN +QRQ      T   G   + +++E  AAA A+GL +     + +L+F LGG T
Sbjct: 185 VPGHFNGNQRQEVSSGSTEYGGFRYVSVVDEQVAAAAAHGLHEDRGDGKVILVFHLGGRT 244

Query: 685 FDVSILTIEDG 717
              +   I DG
Sbjct: 245 AHATKFVIRDG 255



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY----KGEDKTFFP 421
           V+ +  I   KRLIG +  D   +   +  P+++    G+  I+V      K   + F P
Sbjct: 96  VDHSAAISGFKRLIGLQPGDPHAKRVAQIAPYKLGEKIGRCSIQVQLDDGAKCRVEDFLP 155

Query: 422 EEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           E+V+ +++  +K TAEA+LG  + NAV+T P
Sbjct: 156 EDVAGILIAHLKSTAEAHLGHRIDNAVVTVP 186


>06_01_0770 -
           5756200-5756741,5756790-5757286,5757356-5757782,
           5757854-5757911
          Length = 507

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 25/81 (30%), Positives = 40/81 (49%)
 Frame = +1

Query: 514 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDV 693
           +Y  D ++  +  A   SG   +++++E  AAA AYG   K    + +L+F LGG T   
Sbjct: 233 SYSADGRQVLSSAAKEYSGFRAVKVVDEHIAAAAAYGHHTKQGDRKAILVFHLGGRTSHA 292

Query: 694 SILTIEDGIFEVKSTAGDTHF 756
           +I    DG   + +T    HF
Sbjct: 293 TIFKFVDGTARLIATRAH-HF 312



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 20/69 (28%), Positives = 40/69 (57%)
 Frame = +2

Query: 308 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 487
           ED  V+ +++  P++     G   +++     D  F  + ++ ++++ +K TAEA+LG+ 
Sbjct: 164 EDDVVKREIELVPYKFTKMLGWVSVQL---DTDAEFSVDHLAGILISHLKHTAEAHLGRH 220

Query: 488 VQNAVITFP 514
           + NAVIT P
Sbjct: 221 INNAVITLP 229


>06_03_0067 -
           16167420-16167845,16168291-16168406,16168634-16168871,
           16168903-16169033,16169100-16169289
          Length = 366

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -1

Query: 726 LEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDS-ENVQARDGTCI 550
           LE  ++DG D  VE  AAEV+D+  +    L V  V + +  R +DD+ +     D T +
Sbjct: 109 LEHAVVDGYDADVERVAAEVEDE-DALLGPLLVDVVGDGAGGRLVDDAVDGEPGDDATSL 167

Query: 549 FCGLSLRVIEVRGNV 505
               +LR++EV  +V
Sbjct: 168 VACHALRIVEVGQHV 182


>07_01_0786 + 6122144-6123187
          Length = 347

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 445 KHHGTDFLGEKGFVFTLICY-LDLRFASITDNLERPVLHVGLHSSIFELTSDETFGIEYC 269
           KH     +G  G   T +   L L+F     N ++  LH GL  +  + T+DE  G+ + 
Sbjct: 51  KHKAVVVMGATGTGKTRLAVDLALQFGGEVINADKLQLHRGLDVATNKATADERAGVPHH 110

Query: 268 VVGV-HATWFLAASPMRRSVS 209
           ++GV H      A+  RR+ S
Sbjct: 111 LIGVAHPDEEFTAADFRRAAS 131


>09_04_0565 + 18580292-18580571,18582823-18583052
          Length = 169

 Score = 31.1 bits (67), Expect = 1.00
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -1

Query: 195 KTEWSCCPGRWR*SPPSRAGRH 130
           K  WSCC  R   +PP R GRH
Sbjct: 138 KGRWSCCQERDEGAPPCRRGRH 159


>04_03_0694 +
           18781776-18781994,18782475-18782648,18782743-18783057,
           18783791-18785569,18786334-18786651,18787052-18787105
          Length = 952

 Score = 31.1 bits (67), Expect = 1.00
 Identities = 17/58 (29%), Positives = 25/58 (43%)
 Frame = -2

Query: 290 DVWHRILCCWGSRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARV 117
           ++  R+ CC G R  V  G  D T+G+ +R  R S          L L  L+  N  +
Sbjct: 22  EIASRVSCCSGGRGRVAVGCDDGTVGLLDRGFRLSYGFQAYASSVLFLQQLKQRNVLI 79


>04_04_1042 -
           30346132-30346285,30346629-30346759,30346867-30346938,
           30347284-30347370,30347479-30347505,30347777-30347869,
           30348470-30348558,30348649-30348727,30349102-30349231,
           30349344-30349464,30349619-30349726,30349837-30350152
          Length = 468

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)
 Frame = -1

Query: 135 RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLS-KRARLTLV 4
           +H R   W+ D F L +LL F +    CYL L+    +R R  LV
Sbjct: 71  KHARFLNWHLDLFCLILLLVFVLPYYHCYLLLRNSGVRRERALLV 115


>06_03_0953 - 26277946-26278800,26280177-26280676,26280735-26280849
          Length = 489

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +1

Query: 127 LVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTRWRE 258
           L+  +  RW   P  R     +L+LR   P  SSE+P  T+  E
Sbjct: 171 LLGGAERRWSPPPPPRPKPKHKLVLREIEPGESSEVPSETKHSE 214


>10_08_0775 + 20484776-20486035
          Length = 419

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%)
 Frame = +1

Query: 463 CRSLSWQNCA---ECSYHVPAYFNDSQRQATKDA 555
           C+S+  +NC+   EC Y  P+ F D+   A+ DA
Sbjct: 124 CKSIPTRNCSGDGECGYEAPSMFGDTFGIASTDA 157


>08_02_1261 +
           25689487-25689666,25690642-25690887,25691032-25691128,
           25691233-25691630,25692013-25692267
          Length = 391

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 9/35 (25%), Positives = 18/35 (51%)
 Frame = +1

Query: 103 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRS 207
           +W+P+  +L     G W  SP  ++  P  +++ S
Sbjct: 357 VWIPKHFSLSQDKNGSWECSPLEKSVPPAPIIVPS 391


>05_03_0458 + 14280953-14281866,14281964-14282912
          Length = 620

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 662 SLTSAAVPSTCPSLPSRMVSSR*NPPPATPT 754
           SLT+ + PS+ PS P  +   +  PPP  PT
Sbjct: 51  SLTTTSSPSSSPSSPPPLPPLQPTPPPLPPT 81


>08_01_0876 - 8598664-8599374
          Length = 236

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 18/65 (27%), Positives = 25/65 (38%)
 Frame = +1

Query: 148 RWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRCQTSHRT*VRRCYCAS 327
           RW       A+GP R  +    P +    P   R R   + + R     RT  RRC    
Sbjct: 143 RWAKEAAASASGPRRWTMDGAAPLLPETSPKSRRGRRGGRRSPR--RGPRTRRRRCRLRL 200

Query: 328 RHEAL 342
           RH ++
Sbjct: 201 RHRSM 205


>10_01_0121 - 1493822-1494316
          Length = 164

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +2

Query: 71  QNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPG 175
           + G+  R     G   L RWC   R+GG  R R G
Sbjct: 36  RRGRQIRPLEGHGRQRLWRWCSGGRQGGMQRGRSG 70


>11_06_0686 + 26280772-26281611
          Length = 279

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 16/57 (28%), Positives = 22/57 (38%)
 Frame = +2

Query: 107 GYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGVNPNNTIF 277
           GY++    C     GG H+QR G   H      H H  S   C+     V+    +F
Sbjct: 212 GYYLYYWQCTDGLAGGYHQQRGGHYCHCAAGDGHGHYYSPSSCQWHSDRVDSIRQMF 268


>11_06_0370 +
           22768977-22769523,22769619-22770642,22770784-22771170,
           22771216-22771507
          Length = 749

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = +3

Query: 543 HKRCRYHLWLERSPNHQ 593
           H R  Y  WLE +PNHQ
Sbjct: 522 HFRYYYETWLEEAPNHQ 538


>07_03_1728 + 29076733-29079069
          Length = 778

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = -2

Query: 758 PKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP*AIAAAV 600
           P  ++P ++  +  PSS+ R D +  PP  + IS      P +S   A+  +V
Sbjct: 499 PDIMAPGLNILAAWPSSVARTDAAAAPPSFNVISGTSMATPHVSGVAALVKSV 551


>06_03_0501 +
           21476715-21476785,21477045-21477786,21478097-21478246,
           21478350-21478589,21479968-21480048,21480144-21480185,
           21480953-21481033,21481271-21481368,21482574-21482667,
           21482733-21482861,21483881-21483931,21484023-21484049,
           21484280-21484387,21484956-21485201
          Length = 719

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 14/50 (28%), Positives = 21/50 (42%)
 Frame = +2

Query: 134 LPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDA 283
           LP  +G     R G++D   +  +H H A+HR       G      + DA
Sbjct: 200 LPVGDGEGRDGRGGKRDAMHIVGIHAHAAAHRHSHAHVHGACHGGAVNDA 249


>03_04_0025 -
           16557328-16557851,16558000-16558123,16558518-16558654,
           16561050-16561185,16561296-16561721
          Length = 448

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)
 Frame = +2

Query: 86  TRSRNRSGYHVLLRWCLP-AREGGDHRQRPGQQDHSVLCCVHRHRAS 223
           TR + RSG+  L R CL      G  + RPG +  +     H   AS
Sbjct: 2   TRKKERSGWGSLFRGCLSGGGAAGSRKVRPGPRTAAAAAAKHGGGAS 48


>02_01_0302 - 2021221-2023305
          Length = 694

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -2

Query: 758 PKWVSPAVDFTSKIPSSMVRMDTSKVPPPRS 666
           P + SP V +T   P+S  R D    PPP S
Sbjct: 541 PSYPSPPVTYTPPPPTSADRPDVRFAPPPGS 571


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,710,631
Number of Sequences: 37544
Number of extensions: 557326
Number of successful extensions: 2005
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 1808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1938
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2027850416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -