Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_06_0283 - 26917676-26917714,26917987-26918058,26918160-269182...    54   1e-07

>05_06_0283 -
           26917676-26917714,26917987-26918058,26918160-26918251,
           26918500-26918524
          Length = 75

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 29/68 (42%), Positives = 41/68 (60%)
 Frame = +3

Query: 273 LNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVKFDRR 452
           L+ I L +P+KA  +E+++ R AQ G I  K++E  LI +LE  N    K Q+ V   RR
Sbjct: 9   LSRIALVKPDKARGVEDVLLRAAQSGGISEKVSEERLISLLEQINTHTSK-QTKVTIQRR 67

Query: 453 RAALDSDD 476
           R+ LD DD
Sbjct: 68  RSVLDDDD 75


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,719,197
Number of Sequences: 37544
Number of extensions: 254192
Number of successful extensions: 445
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 438
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 445
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1733104716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)