SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0103 + 1082077-1082167,1083037-1085477                          101   5e-22
02_04_0017 + 18937774-18937864,18938505-18940945                      101   5e-22
01_06_0662 + 30987187-30987277,30987825-30990214                       99   2e-21
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     99   3e-21
05_05_0156 + 22792783-22793410,22797153-22797227,22797644-227988...    62   4e-10
03_05_0511 + 25056018-25059107                                         53   3e-07
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    52   4e-07
02_04_0148 - 20198407-20201424                                         52   7e-07
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    50   3e-06
02_02_0474 + 10738476-10738797,10739568-10739677,10739891-107400...    50   3e-06
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    50   3e-06
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    49   5e-06
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    47   2e-05
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    43   2e-04
02_04_0462 + 23131433-23132836                                         39   0.005
03_01_0548 + 4099386-4099847,4100435-4101316                           33   0.19 
03_01_0547 + 4093196-4093657,4094267-4095148                           33   0.19 
03_01_0544 + 4082528-4082989,4083585-4084466                           33   0.19 
03_01_0543 + 4076981-4077442,4078145-4079026                           33   0.19 
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    33   0.34 
05_07_0212 + 28434612-28435931,28436012-28436044,28436557-284366...    32   0.59 
08_02_0059 - 11778739-11780998,11781744-11781751                       31   1.4  
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...    30   2.4  
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...    30   2.4  
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    29   4.1  
05_04_0199 + 18980017-18980759,18981478-18981532                       29   4.1  
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...    28   9.6  
03_05_0990 - 29503950-29504462,29504567-29504686,29514956-295150...    28   9.6  
03_02_0403 + 8160664-8163690                                           28   9.6  
01_06_1466 + 37559600-37559795,37560597-37560730,37561252-375614...    28   9.6  
01_01_0699 + 5405178-5405356,5405478-5405693,5405808-5405919,540...    28   9.6  

>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score =  101 bits (243), Expect = 5e-22
 Identities = 49/66 (74%), Positives = 55/66 (83%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FTV+E+R +MDKK NIRNMSVIAHVDHGKSTLTDSLV+ AGIIA   AG+ R TDTR
Sbjct: 1   MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 238 KDEQDR 255
            DE +R
Sbjct: 61  ADEAER 66



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 48/103 (46%), Positives = 64/103 (62%), Gaps = 1/103 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           C+  VC    +       ERI+P+L +NKMDR            YQTF R++EN NVI+A
Sbjct: 131 CIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSRVIENANVIMA 190

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYAT 766
           TY D    +G+V+V P KG+V F +GLHGWAFTL  F++MYA+
Sbjct: 191 TYEDT--LLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYAS 231



 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 49/84 (58%), Positives = 60/84 (71%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKST IS+F+E+ ++ L       +R+ +E  +LINLIDSPGHVDFSSEVTAALR+TD
Sbjct: 68  ITIKSTGISLFYEMSDESLKLYKG--ERDGNE--YLINLIDSPGHVDFSSEVTAALRITD 123

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVLRQA+
Sbjct: 124 GALVVVDCIEGVCVQTETVLRQAL 147


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score =  101 bits (243), Expect = 5e-22
 Identities = 49/66 (74%), Positives = 55/66 (83%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FTV+E+R +MDKK NIRNMSVIAHVDHGKSTLTDSLV+ AGIIA   AG+ R TDTR
Sbjct: 1   MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 238 KDEQDR 255
            DE +R
Sbjct: 61  ADEAER 66



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 48/103 (46%), Positives = 64/103 (62%), Gaps = 1/103 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           C+  VC    +       ERI+P+L +NKMDR            YQTF R++EN NVI+A
Sbjct: 131 CIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSRVIENANVIMA 190

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYAT 766
           TY D    +G+V+V P KG+V F +GLHGWAFTL  F++MYA+
Sbjct: 191 TYEDT--LLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYAS 231



 Score = 90.6 bits (215), Expect = 1e-18
 Identities = 49/84 (58%), Positives = 60/84 (71%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKST IS+F+E+ ++ L       +R+ +E  +LINLIDSPGHVDFSSEVTAALR+TD
Sbjct: 68  ITIKSTGISLFYEMSDESLKLYKG--ERDGNE--YLINLIDSPGHVDFSSEVTAALRITD 123

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVLRQA+
Sbjct: 124 GALVVVDCIEGVCVQTETVLRQAL 147


>01_06_0662 + 30987187-30987277,30987825-30990214
          Length = 826

 Score =   99 bits (238), Expect = 2e-21
 Identities = 48/103 (46%), Positives = 64/103 (62%), Gaps = 1/103 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           C+  VC    +       ERI+P+L +NKMDR            YQTF R++EN NVI+A
Sbjct: 131 CIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVGGEEAYQTFSRVIENANVIMA 190

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYAT 766
           TY D    +G+V+V P KG+V F +GLHGWAFTL  F++MYA+
Sbjct: 191 TYED--ALLGDVQVYPEKGTVAFSAGLHGWAFTLSNFAKMYAS 231



 Score = 99.5 bits (237), Expect = 3e-21
 Identities = 47/66 (71%), Positives = 55/66 (83%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FTV+E+R +MDKK NIRNMSV+AHVDHGKSTLTDSLV+ AGIIA   AG+ R TD+R
Sbjct: 1   MVKFTVEEMRRIMDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDSR 60

Query: 238 KDEQDR 255
            DE +R
Sbjct: 61  SDEAER 66



 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 48/84 (57%), Positives = 60/84 (71%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKST IS+++E+ ++ L   +    R+ +E  +LINLIDSPGHVDFSSEVTAALR+TD
Sbjct: 68  ITIKSTGISLYYEMSDESLK--SYKGDRDGNE--YLINLIDSPGHVDFSSEVTAALRITD 123

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVLRQA+
Sbjct: 124 GALVVVDCIEGVCVQTETVLRQAL 147


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 48/66 (72%), Positives = 53/66 (80%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FT +E+R  MDKK NIRNMSVIAHVDHGKSTLTDSLV+ AGIIA   AG+ R TDTR
Sbjct: 1   MVRFTAEELRASMDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDTR 60

Query: 238 KDEQDR 255
            DE +R
Sbjct: 61  ADEAER 66



 Score = 92.3 bits (219), Expect = 4e-19
 Identities = 45/101 (44%), Positives = 59/101 (58%), Gaps = 1/101 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           C+  VC    +      AERIKP+L +NKMDR            YQ F R++E+VNV +A
Sbjct: 131 CIEGVCVQTETVLRQSLAERIKPVLTVNKMDRCFLELQQSGEEAYQAFSRVIESVNVTMA 190

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMY 760
            Y D    +G+  V P KG+V F +GLHGWAFTL  F++MY
Sbjct: 191 PYEDKN--LGDCMVAPEKGTVAFSAGLHGWAFTLSNFAKMY 229



 Score = 84.6 bits (200), Expect = 8e-17
 Identities = 44/84 (52%), Positives = 57/84 (67%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKST IS+++E+ +  L       + ++    +LINLIDSPGH+DFSSEVTAALR+TD
Sbjct: 68  ITIKSTGISLYYEMTDAAL----RSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALRITD 123

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVLRQ++
Sbjct: 124 GALVVVDCIEGVCVQTETVLRQSL 147


>05_05_0156 +
           22792783-22793410,22797153-22797227,22797644-22798879,
           22798947-22799155,22799240-22800209,22800395-22800465
          Length = 1062

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 28/88 (31%), Positives = 51/88 (57%)
 Frame = +2

Query: 515 RIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKG 694
           +I+P+  +NK+DR            YQT   ++++VN  ++++ D        +V P+KG
Sbjct: 336 KIQPVFTLNKIDRFFLEQNVDGEKAYQTLSSLIDSVNATMSSHKD-------AQVYPTKG 388

Query: 695 SVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           +V F SGLHGWA  +  F++MY++  ++
Sbjct: 389 TVVFSSGLHGWAVAISNFAKMYSSKFKV 416



 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 1/142 (0%)
 Frame = +3

Query: 240 GRTRPCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTA 419
           G T   +T  ++ IS+++E+ E  L   +  D+R  +  G LINLIDSP   + S++V  
Sbjct: 248 GITSQEVTESNSLISLYYEMPEDSLR--SYKDKR--AGNGHLINLIDSPVCCNLSNDVQP 303

Query: 420 ALRVTDGALXXXXXXXXXXXQTETVLRQAMPSASSLFCS*TKWTVLFLSSNLK-LKNYTR 596
           AL + DGAL            T+T +R+A+        +  K    FL  N+   K Y  
Sbjct: 304 ALCIMDGALVVVDSFEGVTLWTKTSIREALNMKIQPVFTLNKIDRFFLEQNVDGEKAYQT 363

Query: 597 RSSVL*KMLTSL*PHITMMVVP 662
            SS++  +  ++  H    V P
Sbjct: 364 LSSLIDSVNATMSSHKDAQVYP 385



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = +1

Query: 76  DEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGI 192
           +E+  +M  K NIRN+ VIA   HGK+ + DSLV+ AGI
Sbjct: 211 EELHSIMCNKNNIRNVLVIADAGHGKTAILDSLVATAGI 249


>03_05_0511 + 25056018-25059107
          Length = 1029

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 25/50 (50%), Positives = 31/50 (62%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           G  +NLIDSPGH+DF SEV++A R++D AL           QT   LRQA
Sbjct: 74  GHRVNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEGVHIQTHAALRQA 123



 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKA--GIIAGARAGETRFTDTRKDEQDRA 258
           R +RN  ++AHVDHGK+TL D LV+    G++    AG  RF D   +EQ RA
Sbjct: 8   RRVRNTCILAHVDHGKTTLADHLVASCGDGLVHPRLAGRLRFMDYLDEEQRRA 60



 Score = 35.9 bits (79), Expect = 0.036
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +2

Query: 683 PSKGSVGFGSGLHGWAFTLKQFSEMYA 763
           P KG+V F   L GW F + QF+E YA
Sbjct: 210 PQKGNVVFACALDGWGFRIHQFAEFYA 236



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVI 631
           + ER++P L +NK+DR            Y    RI+ +VN I
Sbjct: 124 FLERLRPCLVLNKLDRLISELHLTPAEAYTRLHRIISDVNSI 165


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 23/51 (45%), Positives = 32/51 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K +L N++D+PGHV+FS E+TAALR+ DGA+            TE  +R A
Sbjct: 217 KSYLCNIMDTPGHVNFSDEMTAALRIADGAVLVVDAAEGVMVNTERAIRHA 267



 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 27/83 (32%), Positives = 45/83 (54%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           ER+  ++ +NK+DR            Y   +  +E +N +I++ +   G  G   VDP+ 
Sbjct: 270 ERLPIVVVINKVDRLITELKLPPNDAYFKLRHTLEAINDLISSCSTTVG--GTQLVDPAA 327

Query: 692 GSVGFGSGLHGWAFTLKQFSEMY 760
           G+V F SG  GW+FTL+ F+ +Y
Sbjct: 328 GNVCFASGSAGWSFTLQSFAHLY 350



 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = +1

Query: 70  TVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKA-GIIAGARAGE--TRFTDTRK 240
           T D + G+      +RN++++ H+ HGK+   D LV +   +      GE   RFTDTR 
Sbjct: 134 TTDFLLGLAANPALVRNVALVGHLQHGKTVFMDMLVEQTHEVDTFDSEGERHVRFTDTRV 193

Query: 241 DEQDRASPLNLRP 279
           DEQ+R   +   P
Sbjct: 194 DEQERRVSIKAVP 206


>02_04_0148 - 20198407-20201424
          Length = 1005

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 25/50 (50%), Positives = 30/50 (60%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           G  ++LIDSPGH+DF SEV+AA R+ D AL           QT   LRQA
Sbjct: 86  GHRVHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEGVRVQTHAALRQA 135



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGI---IAGARAGETRFTDTRKDEQDRA 258
           R +RN  ++AHVDHGK++L D L++  G    ++   AG  R  D  ++EQ RA
Sbjct: 14  RRVRNTCILAHVDHGKTSLADHLIAAYGSERRVSERMAGSARVMDHLEEEQRRA 67



 Score = 31.9 bits (69), Expect = 0.59
 Identities = 27/111 (24%), Positives = 39/111 (35%), Gaps = 21/111 (18%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATY-------------- 643
           + ER++P L +NK+DR            +   +RIV  VN I +                
Sbjct: 136 FVERLRPCLVLNKVDRLVAELRLTPAEAHARLRRIVSEVNSIYSALRSRSYFSTLDAACA 195

Query: 644 -------NDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSR 775
                  N D     E    P  G+V F     GW F L   +++ A   R
Sbjct: 196 LSQELPDNGDAADEEEDAFQPQNGNVVFACAREGWGFRLVTLAKLLAPKLR 246


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 24/49 (48%), Positives = 31/49 (63%)
 Frame = +3

Query: 357 GFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           G+ +N+ID+PGHVDF+ EV  ALRV DGA+           Q+ TV RQ
Sbjct: 135 GYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQ 183



 Score = 31.5 bits (68), Expect = 0.78
 Identities = 13/39 (33%), Positives = 23/39 (58%)
 Frame = +1

Query: 79  EIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           E+    +    +RN+ + AH+D GK+TLT+ ++   G I
Sbjct: 57  EVARWRESMDRMRNIGISAHIDSGKTTLTERVLYYTGRI 95


>02_02_0474 +
           10738476-10738797,10739568-10739677,10739891-10740094,
           10740400-10740576,10740659-10740811,10741535-10741624,
           10741939-10742049,10742169-10742285,10742881-10743032,
           10743116-10743200,10743597-10743691,10744211-10744376,
           10744459-10744654,10745662-10745795
          Length = 703

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 19/51 (37%), Positives = 36/51 (70%)
 Frame = +1

Query: 103 KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +R++RN++++AHVDHGK+TL DS++ +A +    +  + R  D+   E++R
Sbjct: 116 RRDVRNIAIVAHVDHGKTTLVDSMLRQAKVFRDNQVVQERIMDSNDLERER 166



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           KG  IN+ID+PGH DF  EV   L + +G L           QT  VL++A+
Sbjct: 180 KGTKINIIDTPGHSDFGGEVERVLNMVEGVLLVVDSVEGPMPQTRFVLKKAL 231


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 24/56 (42%), Positives = 34/56 (60%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLR 276
           NIRN S+IAH+DHGKSTL D L+   G +   R  + +F D    E++R   + L+
Sbjct: 76  NIRNFSIIAHIDHGKSTLADKLLELTGTVQ-KREMKQQFLDNMDLERERGITIKLQ 130



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = +3

Query: 348 SEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           +++ + +NLID+PGHVDFS EV+ +L   +GAL
Sbjct: 139 NDEPYCLNLIDTPGHVDFSYEVSRSLAACEGAL 171


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 26/63 (41%), Positives = 35/63 (55%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+K+   +MF+      L     PD        +L+NLID+PGHVDFS EV+ +L    
Sbjct: 105 ITVKAQTATMFYRHANNQLPASDQPDA-----PSYLLNLIDTPGHVDFSYEVSRSLAACQ 159

Query: 438 GAL 446
           GAL
Sbjct: 160 GAL 162



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/48 (45%), Positives = 31/48 (64%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +RN S+IAHVDHGKSTL D L+   G I     G+ ++ D  + E++R
Sbjct: 57  VRNFSIIAHVDHGKSTLADRLLELTGTIKKGH-GQPQYLDKLQVERER 103


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 26/60 (43%), Positives = 36/60 (60%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + T    + E E++  + IT+P       K   IN+ID+PGHVDF+ EV  ALRV DGA+
Sbjct: 139 EGTVTMDWMEQEQERGITITSPPTTAFWNK-HRINIIDTPGHVDFTLEVERALRVLDGAI 197


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/34 (58%), Positives = 26/34 (76%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           G +D  R IRN++VIAHVDHGK+TL D L+ + G
Sbjct: 57  GALDPSR-IRNVAVIAHVDHGKTTLMDRLLRQCG 89



 Score = 38.3 bits (85), Expect = 0.007
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 366 INLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +N++D+PGH DF  EV   + + +GA+           QT+ VL +A+
Sbjct: 125 LNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEGPLAQTKFVLSKAL 172


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 19/62 (30%), Positives = 31/62 (50%)
 Frame = +1

Query: 85  RGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASP 264
           RG  ++ +   N+  I HVDHGK+TLT +L      + G+   +    D   +E+ R   
Sbjct: 61  RGKFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARGIT 120

Query: 265 LN 270
           +N
Sbjct: 121 IN 122


>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLG 32


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLG 32


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLG 32


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLG 32


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL 273
           N+  I HVDHGK+TLT + ++K    AG +A    F +  K  +++A  + +
Sbjct: 69  NVGTIGHVDHGKTTLT-AAITKVLAEAG-KAKAVAFDEIDKAPEEKARGITI 118


>05_07_0212 +
           28434612-28435931,28436012-28436044,28436557-28436670,
           28436767-28437102,28437221-28437283,28437364-28437519,
           28437650-28437715,28439074-28439310,28439403-28439678,
           28440060-28440248,28440459-28440620
          Length = 983

 Score = 31.9 bits (69), Expect = 0.59
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++++ HVDHGK+TL D  + K+ ++A    G T+
Sbjct: 430 VTIMGHVDHGKTTLLD-YIRKSKVVASEAGGITQ 462


>08_02_0059 - 11778739-11780998,11781744-11781751
          Length = 755

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = -3

Query: 230 SVKRVSPALAPAM-IPALETNESVRVDLP*STWAITDMLRIFRFLSIIPRISSTVK 66
           S++R+ P++     +  ++  +S+  +LP S W IT +  +F    I+PR +  +K
Sbjct: 470 SLRRIHPSIGNLKNLQTIDVRQSLVHELPCSFWKITSLRHVFGSELIVPRWTRELK 525


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           N++++ HVD GKSTL+  L+   G I+
Sbjct: 249 NLAIVGHVDSGKSTLSGRLLHLLGRIS 275


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           N++++ HVD GKSTL+  L+   G I+
Sbjct: 249 NLAIVGHVDSGKSTLSGRLLHLLGRIS 275


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 10/18 (55%), Positives = 16/18 (88%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSL 174
           ++++ HVDHGK++L DSL
Sbjct: 200 VTIMGHVDHGKTSLLDSL 217


>05_04_0199 + 18980017-18980759,18981478-18981532
          Length = 265

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/40 (32%), Positives = 15/40 (37%)
 Frame = +3

Query: 84  PWDDGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWC 203
           PW  GQ    P + C R    R   P+G      R  C C
Sbjct: 190 PWKGGQGGNNPDYECLRAELRRMAPPNGRAVLLFRNRCGC 229


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           K + + L+DSPGH DF   + +    +D A+
Sbjct: 310 KNYHVVLLDSPGHKDFVPNMISGATQSDAAI 340


>03_05_0990 -
           29503950-29504462,29504567-29504686,29514956-29515012,
           29515635-29515689,29515765-29515845,29515928-29515983,
           29516112-29516256,29516347-29516415,29517355-29517467,
           29517619-29517708,29518112-29518176,29519256-29519667
          Length = 591

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +2

Query: 137 TSITASQP--SRTRWFPRPVSLLVREPERPVSLTRVR 241
           +S TAS P  S     PR +SLL R+PERP  L  V+
Sbjct: 44  SSPTASPPADSDDEGSPRGLSLLPRDPERPPRLLVVQ 80


>03_02_0403 + 8160664-8163690
          Length = 1008

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = -1

Query: 685 RVDTHLTHGTTIIVICGYNDVNIFYNTLERLV*FFSFKLELKKSTVHFVHEQNRLD 518
           RVDT++T  TT +V  G+ D ++  NT   +      ++E+K  T H +H   R+D
Sbjct: 799 RVDTNVTSNTTAMVH-GHGD-SMTSNTTAMIR--GDRRVEMKIPTPHLIHGDGRID 850


>01_06_1466 +
           37559600-37559795,37560597-37560730,37561252-37561437,
           37562538-37562753,37563008-37563119,37563493-37563663,
           37564621-37564684,37565555-37565685,37566263-37566393,
           37566843-37566945,37567322-37567398,37567813-37567860,
           37568162-37568311,37568810-37569010
          Length = 639

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -2

Query: 183 LGNQRVREG*LAVIDVGDHRHV-ADIPLLVHHPTDLVYREIHHFRWF 46
           +GN+   +G  A +D   HRH+ A++PL    PTD+   ++  F+WF
Sbjct: 585 IGNE---DGVAAAVD-SFHRHLPAELPL-APPPTDVKEEQLDFFQWF 626


>01_01_0699 +
           5405178-5405356,5405478-5405693,5405808-5405919,
           5406335-5406397,5406468-5406606,5406822-5406877,
           5408088-5408161,5408270-5408417,5408505-5408678,
           5408809-5408896,5408996-5409109,5409728-5409825,
           5409927-5410017,5410440-5410534,5410672-5410825,
           5410864-5410876,5411276-5411384
          Length = 640

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = +2

Query: 131 SPTSITASQPSRTRWFPRPVSLLVREPERPVSLTR 235
           SP    A+ P R  W PRP S     P  P+SL R
Sbjct: 18  SPLPFAAAHPCRASWTPRPTS-----PLPPLSLLR 47


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,101,306
Number of Sequences: 37544
Number of extensions: 471905
Number of successful extensions: 1543
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 1421
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1531
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2091906552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -