SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0548 + 4099386-4099847,4100435-4101316                          156   2e-38
03_01_0547 + 4093196-4093657,4094267-4095148                          156   2e-38
03_01_0544 + 4082528-4082989,4083585-4084466                          156   2e-38
03_01_0543 + 4076981-4077442,4078145-4079026                          156   2e-38
04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165...    97   1e-20
04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558...    97   1e-20
02_03_0105 - 15254959-15255216,15256235-15256299,15257080-152572...    97   1e-20
04_04_1593 - 34661670-34661798,34661882-34661989,34662129-346623...    93   1e-19
04_03_0107 + 11328267-11328276,11329059-11329170,11329862-113299...    91   7e-19
02_04_0462 + 23131433-23132836                                         70   1e-12
03_06_0699 - 35612919-35612989,35613079-35613319,35613506-356135...    69   3e-12
03_05_0044 + 20203644-20204054,20204695-20204916,20205092-202051...    39   0.003
01_06_0734 + 31569017-31569358,31569832-31569906,31570009-315701...    36   0.028
09_04_0730 + 19783346-19783372,19783548-19783638,19783973-197840...    33   0.20 
03_05_0511 + 25056018-25059107                                         33   0.20 
06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240...    33   0.26 
02_01_0432 - 3144560-3144655,3144792-3144832,3145019-3145094,314...    33   0.26 
12_01_0491 - 3884764-3885114,3885143-3885403,3885493-3885711,388...    32   0.34 
02_04_0148 - 20198407-20201424                                         31   0.60 
04_04_0640 - 26891552-26891725,26891814-26892326,26892698-268936...    31   0.79 
04_01_0103 + 1082077-1082167,1083037-1085477                           31   0.79 
02_04_0017 + 18937774-18937864,18938505-18940945                       31   0.79 
01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912     30   1.4  
01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430...    30   1.4  
01_06_0662 + 30987187-30987277,30987825-30990214                       30   1.8  
06_01_0325 - 2366193-2366367,2367063-2367122,2367323-2367463,236...    29   2.4  
05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093...    29   2.4  
01_01_0016 - 88825-90411                                               29   3.2  
12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418...    28   5.6  
03_02_0131 - 5796564-5796605,5797188-5797421,5798415-5798717,579...    28   5.6  
09_01_0015 + 370242-370306,370429-370497,371087-371161,371558-37...    28   7.4  
04_03_0106 + 11325172-11325379,11326590-11326640,11326987-113270...    28   7.4  
03_05_0339 + 23287620-23287676,23287784-23287849,23287937-232880...    28   7.4  
05_07_0067 + 27463703-27463705,27464309-27464365,27464779-274648...    27   9.7  

>03_01_0548 + 4099386-4099847,4100435-4101316
          Length = 447

 Score =  156 bits (378), Expect = 2e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  128 bits (310), Expect = 3e-30
 Identities = 60/66 (90%), Positives = 61/66 (92%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>03_01_0547 + 4093196-4093657,4094267-4095148
          Length = 447

 Score =  156 bits (378), Expect = 2e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  128 bits (310), Expect = 3e-30
 Identities = 60/66 (90%), Positives = 61/66 (92%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>03_01_0544 + 4082528-4082989,4083585-4084466
          Length = 447

 Score =  156 bits (378), Expect = 2e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  128 bits (310), Expect = 3e-30
 Identities = 60/66 (90%), Positives = 61/66 (92%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>03_01_0543 + 4076981-4077442,4078145-4079026
          Length = 447

 Score =  156 bits (378), Expect = 2e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  128 bits (310), Expect = 3e-30
 Identities = 60/66 (90%), Positives = 61/66 (92%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>04_04_1015 -
           30115377-30115477,30115570-30115615,30116491-30116590,
           30116676-30116771,30119519-30119556,30119623-30119733,
           30119820-30119951,30120024-30120263,30120532-30120700,
           30120994-30121493,30121581-30121691,30121802-30122133,
           30122603-30122737,30122839-30122988,30123809-30123947
          Length = 799

 Score = 97.1 bits (231), Expect = 1e-20
 Identities = 47/92 (51%), Positives = 64/92 (69%), Gaps = 5/92 (5%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+ +A+   ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG+
Sbjct: 308 ERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAGM 367

Query: 436 SKN-----GQTREHALLAFTLGVKQLIVGETK 516
                   GQT+EHA L  + GV+QLIV   K
Sbjct: 368 DGEGGKSVGQTKEHAQLIRSFGVEQLIVAVNK 399



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 51/194 (26%), Positives = 93/194 (47%), Gaps = 6/194 (3%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 305

Query: 251 ELS---VVSQSILLSGSSKLASTMLPS---LMLLDTEISSRT*SQEPLRLIALCSS*LPV 412
           E      ++ ++    + K    +L S      +   IS  T +   + ++  C+     
Sbjct: 306 ERERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEA 365

Query: 413 PVNSKLVSLRTVKXXXXXXXXXXXXXXXXXXEKQNGSTEPPYSEPRFEEIKKEVSSYIKK 592
            ++ +    ++V                      N      YS+ RFE IK ++ S+++ 
Sbjct: 366 GMDGE--GGKSVGQTKEHAQLIRSFGVEQLIVAVNKMDAIGYSKERFEFIKVQLGSFLRS 423

Query: 593 IGYNPAAVAFVPIS 634
             +  ++V ++P+S
Sbjct: 424 CNFKDSSVTWIPLS 437


>04_04_1008 -
           30054674-30054774,30054867-30054912,30055788-30055887,
           30055973-30056068,30058816-30058853,30058920-30059030,
           30059117-30059248,30059321-30059560,30059829-30059997,
           30060291-30060790,30060878-30060988,30061099-30061430,
           30061900-30062034,30062136-30062285,30063106-30063244
          Length = 799

 Score = 97.1 bits (231), Expect = 1e-20
 Identities = 47/92 (51%), Positives = 64/92 (69%), Gaps = 5/92 (5%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERG+T+ +A+   ET KY V ++D+PGH+DF+ NMI+G +QAD A+L+V A TG FEAG+
Sbjct: 308 ERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEAGM 367

Query: 436 SKN-----GQTREHALLAFTLGVKQLIVGETK 516
                   GQT+EHA L  + GV+QLIV   K
Sbjct: 368 DGEGGKSVGQTKEHAQLIRSFGVEQLIVAVNK 399



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 51/194 (26%), Positives = 93/194 (47%), Gaps = 6/194 (3%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 246 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 305

Query: 251 ELS---VVSQSILLSGSSKLASTMLPS---LMLLDTEISSRT*SQEPLRLIALCSS*LPV 412
           E      ++ ++    + K    +L S      +   IS  T +   + ++  C+     
Sbjct: 306 ERERGVTMTVAVAYLETKKYRVVLLDSPGHKDFVPNMISGATQADAAILVVDACTGSFEA 365

Query: 413 PVNSKLVSLRTVKXXXXXXXXXXXXXXXXXXEKQNGSTEPPYSEPRFEEIKKEVSSYIKK 592
            ++ +    ++V                      N      YS+ RFE IK ++ S+++ 
Sbjct: 366 GMDGE--GGKSVGQTKEHAQLIRSFGVEQLIVAVNKMDAIGYSKERFEFIKVQLGSFLRS 423

Query: 593 IGYNPAAVAFVPIS 634
             +  ++V ++P+S
Sbjct: 424 CNFKDSSVTWIPLS 437


>02_03_0105 -
           15254959-15255216,15256235-15256299,15257080-15257215,
           15257314-15257419,15257642-15257792,15258817-15258881,
           15258980-15259134,15259219-15259281,15259846-15259917,
           15260364-15260408
          Length = 371

 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 43/82 (52%), Positives = 58/82 (70%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  
Sbjct: 15  KGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYE 74

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           + GQTREH LLA TLGV +L+V
Sbjct: 75  RGGQTREHVLLAKTLGVSKLVV 96


>04_04_1593 -
           34661670-34661798,34661882-34661989,34662129-34662368,
           34662614-34662782,34662872-34663362,34663681-34663991,
           34664396-34664473,34665034-34665228,34665363-34665524,
           34665759-34665840
          Length = 654

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 41/85 (48%), Positives = 61/85 (71%), Gaps = 2/85 (2%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGIT+ + +  F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+
Sbjct: 295 ERGITMTVGVAYFDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGM 354

Query: 436 SKN--GQTREHALLAFTLGVKQLIV 504
             N  GQT+EH+ L  + GV  LIV
Sbjct: 355 GINGIGQTKEHSQLVRSFGVDNLIV 379



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 634
           YS+ RF  IK ++ ++++  GY  +AVA+VPIS
Sbjct: 389 YSKERFNFIKSQLGAFLRSCGYKDSAVAWVPIS 421


>04_03_0107 +
           11328267-11328276,11329059-11329170,11329862-11329907,
           11330185-11330256,11332292-11332303,11332880-11332942,
           11333038-11333192,11333303-11333367,11334645-11334795,
           11335230-11335335,11335440-11335575,11336310-11336374,
           11337003-11337188,11337298-11337399
          Length = 426

 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 4/86 (4%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAP----GHRDFIKNMITGTSQADCAVLIVAAGTGEFE 426
           +G T+++    FET     TI+DAP    GH+ ++ NMI+G SQAD  VL+++A  GEFE
Sbjct: 56  KGKTVEVGRAHFETETTRFTILDAPVKMKGHKSYVPNMISGASQADIGVLVISARKGEFE 115

Query: 427 AGISKNGQTREHALLAFTLGVKQLIV 504
            G  K GQTREH LLA TLGV +LIV
Sbjct: 116 TGYEKGGQTREHVLLAKTLGVAKLIV 141



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 20/50 (40%), Positives = 35/50 (70%)
 Frame = +2

Query: 104 DSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           D+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D  + E
Sbjct: 4   DAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNEEE 53


>02_04_0462 + 23131433-23132836
          Length = 467

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 35/82 (42%), Positives = 51/82 (62%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ET   +   +D PGH D++KNMITG +Q D A+L+V+   G       
Sbjct: 117 RGITINTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP---- 172

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QT+EH LLA  +GV +++V
Sbjct: 173 ---QTKEHILLAKQVGVPKIVV 191



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKG 211
           K  + K H+NI  IGHVD GK+T T  L   +   GG   +  ++ +   +E  +G
Sbjct: 63  KFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARG 118


>03_06_0699 -
           35612919-35612989,35613079-35613319,35613506-35613568,
           35613644-35613709,35614110-35614193,35614685-35614890,
           35614977-35615067,35615176-35615280,35615552-35615626,
           35615728-35615820,35615914-35615989,35616115-35616305
          Length = 453

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 36/81 (44%), Positives = 50/81 (61%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI  A  ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+A  G       
Sbjct: 114 RGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMP---- 169

Query: 439 KNGQTREHALLAFTLGVKQLI 501
              QT+EH LLA  +GV  L+
Sbjct: 170 ---QTKEHILLARQVGVPSLV 187



 Score = 34.7 bits (76), Expect = 0.064
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 211
           + K H+N+  IGHVD GK+T T     ++ + G       ++ +K  +E  +G
Sbjct: 63  RTKPHVNVGTIGHVDHGKTTLTAAITKVLAEAGKAKAVAFDEIDKAPEEKARG 115


>03_05_0044 +
           20203644-20204054,20204695-20204916,20205092-20205130,
           20206275-20206396,20206489-20206639,20207892-20207963,
           20208256-20208351,20208861-20208949,20209068-20209134,
           20210197-20210235,20210369-20210429,20210572-20210681,
           20210766-20210840,20210914-20210982,20213126-20213247,
           20214682-20214807,20214897-20215017,20215133-20215233,
           20215564-20215624,20216560-20216613,20217585-20217689
          Length = 770

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 23/71 (32%), Positives = 34/71 (47%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITI  A      + Y V IID PGH DF   +       D A+L++ +  G     I
Sbjct: 119 EKGITIQSAATYCTWNGYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSI 178

Query: 436 SKNGQTREHAL 468
           + + Q R + +
Sbjct: 179 TVDRQMRRYEI 189



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +  H+DSGK+T T  ++Y  G I
Sbjct: 70  NIGISAHIDSGKTTLTERVLYYTGRI 95


>01_06_0734 +
           31569017-31569358,31569832-31569906,31570009-31570159,
           31570716-31570784,31570864-31571036,31571474-31571611,
           31571747-31571872,31571951-31572049,31573175-31573298,
           31573465-31573528,31573798-31573852,31573951-31574075,
           31574228-31574301,31574436-31574485,31574722-31574808,
           31574897-31574947,31575025-31575108,31575400-31575498
          Length = 661

 Score = 35.9 bits (79), Expect = 0.028
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI   +      +  + ++D PGH DF   +       + AVL+V AG G
Sbjct: 106 ERGITIASKVTSVSWKENELNMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEG 159



 Score = 31.5 bits (68), Expect = 0.60
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           N+ VI HVD GK+T    L+ +CG
Sbjct: 66  NVAVIAHVDHGKTTLMDRLLRQCG 89


>09_04_0730 +
           19783346-19783372,19783548-19783638,19783973-19784051,
           19784410-19784743,19784934-19785968,19786141-19786290,
           19786781-19787215
          Length = 716

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +1

Query: 262 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           GIT  I  +  E  S   +T +D PGH  F      G +  D  VL+VAA  G
Sbjct: 229 GITQHIGAFVVEMPSGASITFLDTPGHAAFSAMRARGAAVTDIVVLVVAADDG 281


>03_05_0511 + 25056018-25059107
          Length = 1029

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           R IT+  A        + V +ID+PGH DF   + +    +D A+++V A  G
Sbjct: 59  RAITMKSAAVVLHHGGHRVNLIDSPGHIDFCSEVSSAARLSDSALILVDAVEG 111



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           N  ++ HVD GK+T   HL+  CG
Sbjct: 12  NTCILAHVDHGKTTLADHLVASCG 35


>06_03_0715 -
           23823427-23823525,23823616-23823822,23823907-23824017,
           23824124-23824322,23824410-23824495,23824940-23825098,
           23825204-23825302,23825385-23826578,23826666-23826734,
           23828042-23828812
          Length = 997

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 17/53 (32%), Positives = 24/53 (45%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           + + + + L       Y   I+D PGH +F   M      AD AVL+V A  G
Sbjct: 203 KAVPMSLVLEGGNGKSYLCNIMDTPGHVNFSDEMTAALRIADGAVLVVDAAEG 255


>02_01_0432 -
           3144560-3144655,3144792-3144832,3145019-3145094,
           3145465-3145542,3146121-3146208,3146613-3146686,
           3147445-3147579,3147699-3147770,3148239-3148325,
           3148418-3148522,3149028-3149085,3149576-3149634,
           3149960-3150056,3150217-3150317,3150443-3150487,
           3150619-3150681,3151082-3151147,3151286-3151342,
           3151570-3151656,3152063-3152239,3152413-3152625
          Length = 624

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIALWKFE----TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI +   +         Y + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 122 ERGITIKLQAARMRYIMNDEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 179



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 178
           N  +I H+D GKST    L+   G + KR +++
Sbjct: 79  NFSIIAHIDHGKSTLADKLLELTGTVQKREMKQ 111


>12_01_0491 -
           3884764-3885114,3885143-3885403,3885493-3885711,
           3885792-3886019,3886378-3886480,3886703-3886815,
           3887262-3887323,3887915-3888104
          Length = 508

 Score = 32.3 bits (70), Expect = 0.34
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH      + +
Sbjct: 149 HVSFVDCPGHDILMATMLNGAAIMDGALLLIAANES------CPQPQTSEHLAAVEIMRL 202

Query: 490 KQLIVGETK 516
           + +I+ + K
Sbjct: 203 QHIIILQNK 211


>02_04_0148 - 20198407-20201424
          Length = 1005

 Score = 31.5 bits (68), Expect = 0.60
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           V +ID+PGH DF   +      AD A+++V A  G
Sbjct: 89  VHLIDSPGHIDFCSEVSAAARLADSALVLVDAAEG 123



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 202
           N  ++ HVD GK++   HLI   G  ++R  E+    A+ M
Sbjct: 18  NTCILAHVDHGKTSLADHLIAAYGS-ERRVSERMAGSARVM 57


>04_04_0640 -
           26891552-26891725,26891814-26892326,26892698-26893644,
           26893778-26894114,26894413-26894462,26895020-26895248
          Length = 749

 Score = 31.1 bits (67), Expect = 0.79
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           ERGITI         +K+ + IID PGH DF   +       D A++ +
Sbjct: 152 ERGITITSPPTTAFWNKHRINIIDTPGHVDFTLEVERALRVLDGAIMSI 200



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +2

Query: 74  HINIVVIGHVDSGKSTTTGHLIYKCG 151
           HI+ V++ H+D+GK+TTT  ++Y  G
Sbjct: 105 HIS-VIMAHIDAGKTTTTERVLYYTG 129


>04_01_0103 + 1082077-1082167,1083037-1085477
          Length = 843

 Score = 31.1 bits (67), Expect = 0.79
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 29  QFVIRD*PKMGKEKTHI-NIVVIGHVDSGKSTTTGHLIYKCG 151
           +F + +  ++  +K +I N+ VI HVD GKST T  L+   G
Sbjct: 3   KFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 301 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>02_04_0017 + 18937774-18937864,18938505-18940945
          Length = 843

 Score = 31.1 bits (67), Expect = 0.79
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 29  QFVIRD*PKMGKEKTHI-NIVVIGHVDSGKSTTTGHLIYKCG 151
           +F + +  ++  +K +I N+ VI HVD GKST T  L+   G
Sbjct: 3   KFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 301 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>01_06_0548 - 30137139-30139196,30139279-30139691,30139822-30139912
          Length = 853

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+   G
Sbjct: 13  MDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAG 44



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +1

Query: 274 DIALWKFETSK----YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           D AL  FE  +    Y + +ID+PGH DF   +       D A+++V
Sbjct: 83  DAALRSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALRITDGALVVV 129


>01_05_0487 +
           22641133-22642182,22642276-22642863,22642961-22643068,
           22643582-22643692,22643784-22643849,22644858-22644917,
           22644990-22645119,22645159-22645547,22645783-22645902,
           22645957-22646022,22646190-22646255
          Length = 917

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +ID PGH+ F      G+S  D A+L+V
Sbjct: 489 VIDTPGHQSFSNLRTRGSSLCDIAILVV 516


>01_06_0662 + 30987187-30987277,30987825-30990214
          Length = 826

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ V+ HVD GKST T  L+   G
Sbjct: 13  MDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAG 44



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 301 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>06_01_0325 -
           2366193-2366367,2367063-2367122,2367323-2367463,
           2368175-2368288,2368444-2368475,2368736-2368793,
           2369263-2369434,2369584-2370334,2370743-2371036
          Length = 598

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +   Y + +ID PGH DF   +    +    A+L+V A  G
Sbjct: 130 DAPSYLLNLIDTPGHVDFSYEVSRSLAACQGALLVVDAAQG 170



 Score = 27.9 bits (59), Expect = 7.4
 Identities = 13/28 (46%), Positives = 15/28 (53%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           N  +I HVD GKST    L+   G I K
Sbjct: 59  NFSIIAHVDHGKSTLADRLLELTGTIKK 86


>05_07_0329 -
           29308867-29308932,29309040-29309159,29309245-29309364,
           29309566-29310123,29310199-29310258,29310839-29310904,
           29310993-29311103,29311167-29311257,29311349-29311449,
           29311534-29311641,29311737-29314205
          Length = 1289

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +ID PGH  F      G+S  D A+L+V
Sbjct: 766 VIDTPGHESFSNLRSRGSSLCDIAILVV 793


>01_01_0016 - 88825-90411
          Length = 528

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -3

Query: 504 YDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSA 385
           YD  F     + +G+L  L+V+    F+ TGT + D+H A
Sbjct: 241 YDAAF--RDHARRGLLPALSVIEPRYFDLTGTPADDDHPA 278


>12_02_0457 +
           19239816-19241319,19241337-19241632,19241729-19241829,
           19241939-19242029,19242158-19242268,19242360-19242425,
           19242457-19242462
          Length = 724

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +ID PGH  F      G S  D AV++V
Sbjct: 507 VIDTPGHESFSNMRSRGMSLCDIAVVVV 534


>03_02_0131 -
           5796564-5796605,5797188-5797421,5798415-5798717,
           5799260-5799847,5800594-5800749,5800861-5800919,
           5801935-5802262
          Length = 569

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = -2

Query: 613 SSWVVANLLDV*GYFLLDFLKSGLTVWWFSGTI 515
           ++W   N+ +   ++L + LKSGLT+W F GT+
Sbjct: 461 AAWRKTNIRETYHFWLKENLKSGLTLWKF-GTL 492


>09_01_0015 +
           370242-370306,370429-370497,371087-371161,371558-371591,
           371659-373132,373193-373310,373374-373419
          Length = 626

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 3/99 (3%)
 Frame = +2

Query: 143 KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAELSVVSQSILLSGSSK---LASTM 313
           KC  I +     F K+A  +        W + KLK     + ++IL  GS+    L +T+
Sbjct: 302 KCMDISQAEFFPFSKKAIFLQNDVLNAIWSIQKLKKGDLKLLRAILCQGSNDEMLLKTTV 361

Query: 314 LPSLMLLDTEISSRT*SQEPLRLIALCSS*LPVPVNSKL 430
              L+    E        E LR IALC+    +P+  K+
Sbjct: 362 RRYLIDCLFECDEGDLPDEALRAIALCNQ---MPLRQKI 397


>04_03_0106 +
           11325172-11325379,11326590-11326640,11326987-11327073,
           11327276-11327373
          Length = 147

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSG 112
           K H+N+V IGHVD G
Sbjct: 104 KRHLNVVFIGHVDPG 118


>03_05_0339 +
           23287620-23287676,23287784-23287849,23287937-23288048,
           23288240-23288368,23288795-23288866,23289245-23289360,
           23289494-23289570,23289788-23290273,23290373-23290688,
           23290769-23290915
          Length = 525

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = -3

Query: 435 DTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLA 301
           D    F+G  +  +   I LRG+ +HVLDE    RS++D   VL+
Sbjct: 350 DKLIHFSGV-AMGQACTIVLRGASEHVLDE--AERSLHDALCVLS 391


>05_07_0067 +
           27463703-27463705,27464309-27464365,27464779-27464844,
           27464985-27465096,27465281-27465409,27466076-27466191,
           27466364-27466440,27466678-27467163,27467255-27467570,
           27467618-27467797
          Length = 513

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = -3

Query: 435 DTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLA 301
           D    F+G     +   I LRG+ +HVLDE    RS++D   VL+
Sbjct: 327 DRLIHFSGV-EMGQACTIVLRGASEHVLDE--AERSLHDALCVLS 368


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,195,562
Number of Sequences: 37544
Number of extensions: 382393
Number of successful extensions: 1161
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1093
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1155
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1608522592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -